DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:397 Identity:121/397 - (30%)
Similarity:157/397 - (39%) Gaps:81/397 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 QPPPEVPDNPFLIPTPRTTTTTTTTTPAPIPDTSAAPLIEPRGTVCRGPDTKPGNCVEIKECASL 183
            ||.|..|        |.||....||:|     .:.|.|..|..|..|   ..||       .|| 
Human   772 QPLPMSP--------PSTTRMLATTSP-----RTTAGLTVPGATPSR---PTPG-------AAS- 812

  Fly   184 LNELRSRSQDATFANFLRASNAVCQNKGTQVCCPTGQGITNTTPAPSQIVPKNTDEIPRRLLNVE 248
                |...|.|              |........|.:|   .||.|.........::|       
Human   813 ----RVTGQPA--------------NSTLSAVSTTARG---QTPFPDAPEATTHTQLP------- 849

  Fly   249 EGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI------ 307
             .||.......:||||..:.:|.|||...|..   .....:||..|:..|.:|:||||.      
Human   850 -DCGLAPAALTRIVGGSAAGRGEWPWQVSLWL---RRREHRCGAVLVAERWLLSAAHCFDVYGDP 910

  Fly   308 RQDLQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICL 372
            :|...|  ||...||  ...|.:: .:||...||.||......|:|:|.|...|..:..:.||||
Human   911 KQWAAF--LGTPFLS--GAEGQLE-RVARIYKHPFYNLYTLDYDVALLELAGPVRRSRLVRPICL 970

  Fly   373 PHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDK 437
            |..|   .:...|....:.|||...|||..|:.|.:..:.:...:.|        |.|...|...
Human   971 PEPA---PRPPDGTRCVITGWGSVREGGSMARQLQKAAVRLLSEQTC--------RRFYPVQISS 1024

  Fly   438 AVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDW 502
            .:||||...||.|:|.||:||||...|| .|  |:.|.||.|:|.||.||:.||||:.......|
Human  1025 RMLCAGFPQGGVDSCSGDAGGPLACREP-SG--RWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGW 1086

  Fly   503 IIQQVQD 509
            |.|.:|:
Human  1087 IGQHIQE 1093

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 9/51 (18%)
Tryp_SPc 260..503 CDD:214473 86/248 (35%)
Tryp_SPc 261..503 CDD:238113 86/247 (35%)
TMPRSS9NP_001382442.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.