DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG8170

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:594 Identity:157/594 - (26%)
Similarity:248/594 - (41%) Gaps:175/594 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LPPPTVAQFNQRRQVRQNCITPENYYGSCVALT--YCPQVVNIFQTTSRDRAQRYVIALQRSCGT 81
            :||||..:.::.|..||      .|:.|..|.:  ..|.:|:        .::.:.:.|.|...|
  Fly   318 VPPPTQYEQHETRHTRQ------LYFDSDTASSSFEFPGLVS--------NSKPHGLKLYRDDVT 368

  Fly    82 R--SINGDPVICCTEPRYNPVT----ERPRNPFFPSESTF-IGPQPP-----PEVPDNPFLIP-- 132
            :  .|||            |:|    :||:..|:..::.| .||..|     |:.....::.|  
  Fly   369 KFGDING------------PITALPQQRPQRGFYFGDTEFRTGPPAPVRQFGPQKNFQEYVGPSE 421

  Fly   133 ----------------TPR----TTTTTTTTTPAPIPDTSAAPLIEPRGTVCRGPDTKPGNCV-- 175
                            :||    |.....||.|:           .|.|:  .||.   ||.|  
  Fly   422 YQGTRKSRYYPYKSSRSPRVVFPTNDNVGTTGPS-----------GPAGS--SGPS---GNGVYF 470

  Fly   176 -----------EIKECASL--------LNELRSRSQ-------DATFANFLR-ASNAVCQNKG-- 211
                       .|.|.|::        |.:|.|.|:       .:||...:. .::..||::|  
  Fly   471 SDNIAFRDQNFGINELAAVQDVRNDYSLQDLDSASEATSSPQSASTFKEKVDITTDTECQHRGGT 535

  Fly   212 ---------------------TQVCCPTGQGITNTTPAPSQIVPKNTD--EIPRR---LLNVEEG 250
                                 .:.||.......|.  ..|..|....|  ::|::   .:|.|..
  Fly   536 CEFFLGCWLSGGLIQGTCDGLLRGCCHRTAKSANL--GSSDFVGNAVDLTDLPQKNYGPVNNEPS 598

  Fly   251 CGSTVG---YFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI----- 307
            ||.::.   ..::||||:.:..|::||.|.:..    ||. :|||:||:.|||:||.||:     
  Fly   599 CGISLAKQTAQRRIVGGDDAGFGSFPWQAYIRI----GSS-RCGGSLISRRHVVTAGHCVARATP 658

  Fly   308 RQDLQFVRLGEHDLSTDTE-TGHVDINIARYVSHP--DYNRRNGRSDMAILYLERNVEFTSKIAP 369
            ||  ..|.||::.:::..| .......:.|...||  .:..:..|.|:::|.|||.|.|...|||
  Fly   659 RQ--VHVTLGDYVINSAVEPLPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAP 721

  Fly   370 ICLPHTANLRQKSYVGYMPFVAGWGKTMEGGE-SAQVLNELQIPIYDNKVCVQSYAKEKRYFSAD 433
            ||||.    :.:.::|...:.||||....|.. ..:.|..:.:|:.:|::|       :|:...:
  Fly   722 ICLPE----KNEDFLGKFGWAAGWGALNPGSRLRPKTLQAVDVPVIENRIC-------ERWHRQN 775

  Fly   434 QFD----KAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYS 494
            ..:    :.:||||..:||||:||||||||||    :....|:|||||||.|..||....||:|.
  Fly   776 GINVVIYQEMLCAGYRNGGKDSCQGDSGGPLM----HDKNGRWYLIGVVSAGYSCASRGQPGIYH 836

  Fly   495 STQYFMDWI 503
            |....:||:
  Fly   837 SVSKTVDWV 845

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829 11/59 (19%)
CLIP 164..216 CDD:288855 17/103 (17%)
Tryp_SPc 260..503 CDD:214473 91/255 (36%)
Tryp_SPc 261..503 CDD:238113 91/254 (36%)
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 91/255 (36%)
Tryp_SPc 612..846 CDD:238113 92/256 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.