DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and flz

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:413 Identity:133/413 - (32%)
Similarity:189/413 - (45%) Gaps:80/413 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PTPRTTT----------TTTTTTPAPIPDTSAAPLIEPRGTVCRGPDTKPGNCVEIKECASLLNE 186
            |..|.||          :|||..||....|.||.:.    |..|.|.||...           ..
  Fly  1313 PVTRVTTKAPNKKTSAVSTTTRKPATRRTTVAAKVT----TTTRRPATKKPT-----------RR 1362

  Fly   187 LRSRSQDATFANFLRASNAVCQNKGTQVCCPT------GQGIT----------------NTTPAP 229
            :.|..:..|.::...|.:.:...:..:...|.      .||.|                .|.|.|
  Fly  1363 VSSTVKTTTVSSARPADDEIVDEEDEEDVNPNPSDNEIDQGATLSSYGGANGRKIHSTSRTLPTP 1427

  Fly   230 SQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSG--SPFKCGG 292
            :......:.|...| .:|:.|         :||||:.|..||:||..|:......|  :..||||
  Fly  1428 NLAFHSPSTECGVR-PHVKSG---------RIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGG 1482

  Fly   293 TLITARHVLTAAHC---IRQDLQFVRLGEHDLSTDTETGH-VDINIARYVSHPDYNRRNGRSDMA 353
            .|||:|:|:|||||   ....|..| :||.|:|.|.|:.. |..|:.|.:.|..|:.....:|:|
  Fly  1483 VLITSRYVITAAHCQPGFLASLVAV-MGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLA 1546

  Fly   354 ILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKV 418
            :|.|:..|:|.:.|.|||:|:..    ..:.|.|..|.|||:...||....||.|:|:||.:|.|
  Fly  1547 LLELDSPVQFDTHIVPICMPNDV----ADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSV 1607

  Fly   419 CVQSYAKEKRYFSADQFDK---AVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSY 480
            |      ::.:.:|....|   :.||||..:|.||:|:|||||||:|..| .|  |:.|.|.||:
  Fly  1608 C------QEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRP-DG--RYELAGTVSH 1663

  Fly   481 GIGCARPNVPGVYSSTQYFMDWI 503
            ||.||.|.:||||..|.::..|:
  Fly  1664 GIKCAAPYLPGVYMRTTFYKPWL 1686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 7/51 (14%)
Tryp_SPc 260..503 CDD:214473 101/251 (40%)
Tryp_SPc 261..503 CDD:238113 101/250 (40%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 102/252 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.