DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and prss60.3

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:279 Identity:94/279 - (33%)
Similarity:131/279 - (46%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHC--- 306
            |||   ||. .....:||||..:..|:|||...| :....|..| |||:||::..|||||||   
Zfish    24 LNV---CGQ-APLNTRIVGGVNASPGSWPWQVSL-HSPKYGGHF-CGGSLISSEWVLTAAHCLSG 82

  Fly   307 IRQDLQFVRLGEHDLSTDTETGHVDI-----NIARYVSHPDYNRRNGRSDMAILYLERNVEFTSK 366
            :.:....|.||..     |:.| ::|     |:|:...|..||.....:|:|:|.|...|.||:.
Zfish    83 VSETTLVVYLGRR-----TQQG-INIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNY 141

  Fly   367 IAPICLPHTANLRQKSY--VGYMPFVAGWGKTMEGGE--SAQVLNELQIPIYDNKVCVQSYAKEK 427
            |.|:||     ..|.|.  .|...::.|||....|..  :..:|.|..||:..|..|       .
Zfish   142 IRPVCL-----AAQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRC-------N 194

  Fly   428 RYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLI----GVVSYGIGCARPN 488
            ....:......::|||:..|||||||||||||::        .|...:    |:.|:|.|||.||
Zfish   195 ALLGSGTVTNNMICAGLTQGGKDTCQGDSGGPMV--------TRLCTVWVQAGITSWGYGCADPN 251

  Fly   489 VPGVYSSTQYFMDWIIQQV 507
            .||||:....:..||..::
Zfish   252 SPGVYTRVSQYQSWISSKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 87/258 (34%)
Tryp_SPc 261..503 CDD:238113 87/257 (34%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 89/260 (34%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.