DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Prss34

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:301 Identity:93/301 - (30%)
Similarity:149/301 - (49%) Gaps:55/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LNVEEGCG-STVGYFKKIVGGEVSRKGAWPW-IALLGYD-DPSGSPFKCGGTLITARHVLTAAHC 306
            |.::.|.| ..||    ||||.......:|| ::|..|| :.|....:|||:||..:.|||||||
Mouse    22 LTLDLGSGQGLVG----IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHC 82

  Fly   307 IR-QDLQF----VRLGEHDLSTDTETGHVDINIARYVSHPDYNRR---NGRSDMAILYLERNVEF 363
            :| ::::.    |::|:..|..:.:.    :.:.:.:.||.::.:   .|.:|:|:|.|:..|..
Mouse    83 VRPKEVEAYGVRVQVGQLRLYENDQL----MKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVL 143

  Fly   364 TSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGG---ESAQVLNELQIPIYDNKVCVQSYAK 425
            :..:.|:.|| .|:||..|  ....:||||| .:|..   .....|.|:.:||.:|..|.|.|..
Mouse   144 SEHVYPVSLP-AASLRISS--KKTCWVAGWG-VIENYMPLPPPYHLREVAVPIVENNDCEQKYQT 204

  Fly   426 EKRYFSADQFDKAV----LCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCAR 486
            ..   |:|...:.:    ||||  ..|:|:|:.||||||:.    :....:..:||||:||||..
Mouse   205 NS---SSDSTTRIIKDDMLCAG--KEGRDSCKADSGGPLVC----RWNCSWVQVGVVSWGIGCGL 260

  Fly   487 PNVPGVYSSTQYFMDWI----------------IQQVQDTP 511
            |:.||||:....::.||                |...::||
Mouse   261 PDFPGVYTRVMSYVSWIKCYVPTFLEPLKGPDGIHTTEETP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 83/259 (32%)
Tryp_SPc 261..503 CDD:238113 83/258 (32%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 84/259 (32%)
Tryp_SPc 35..277 CDD:214473 83/258 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.