DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Tmprss11g

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_796136.2 Gene:Tmprss11g / 320454 MGIID:2444058 Length:417 Species:Mus musculus


Alignment Length:291 Identity:91/291 - (31%)
Similarity:139/291 - (47%) Gaps:41/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 SQIVPKNTDEIP----------RRLLNVEEGCGSTVGY--FKKIVGGEVSRKGAWPWIALLGYDD 282
            ||.:.|....:|          ..:||.:  |||.:.|  ..:|..|:.:.|.:|||.:.|..: 
Mouse   145 SQSILKRDASLPYLREMNAAQAEHILNSD--CGSGMEYPPIARIADGKPADKASWPWQSSLQVE- 206

  Fly   283 PSGSPFKCGGTLITARHVLTAAHCI----RQDLQFVRLGEHDLSTDTETGHVDINIARYVSHPDY 343
               ....||.:||.::.::|:|||.    ...|..|..| ..||:...|..|:    ..:.|.:|
Mouse   207 ---GIHLCGASLIGSQWLVTSAHCFDNYKNPKLWTVSFG-RTLSSPLTTRKVE----SIIVHENY 263

  Fly   344 NRRNGRSDMAILYLERNVEFTSKIAPICLPH-TANLRQKSYVGYMPFVAGWGKTMEGGESAQVLN 407
            .......|:|::.|...|.|:..:..:|||. |..:..||.|    ||.|||.....|.....|.
Mouse   264 ASHKHDDDIAVVKLSSPVLFSENLHRVCLPDATFQVLPKSKV----FVTGWGALKANGPFPNSLQ 324

  Fly   408 ELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRF 472
            |::|.|..|.||.|...    |..|  ....::|||.|:|..|.|:|||||||::.:   .:.::
Mouse   325 EVEIEIISNDVCNQVNV----YGGA--ISSGMICAGFLTGKLDACEGDSGGPLVISD---NRNKW 380

  Fly   473 YLIGVVSYGIGCARPNVPGVYSSTQYFMDWI 503
            ||:|:||:||.|.:.|.||:|:...::.|||
Mouse   381 YLLGIVSWGIDCGKENKPGIYTRVTHYRDWI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 79/247 (32%)
Tryp_SPc 261..503 CDD:238113 79/246 (32%)
Tmprss11gNP_796136.2 SEA 48..142 CDD:279699
Tryp_SPc 185..411 CDD:214473 79/247 (32%)
Tryp_SPc 186..414 CDD:238113 81/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.