DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Tmprss6

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:361 Identity:116/361 - (32%)
Similarity:164/361 - (45%) Gaps:70/361 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 PRGTVC-RGPDTKPGN----CVEIKECASLLNELRSRSQDATFANFLRASNAVCQNKGTQVCCPT 218
            ||  || |.||...|:    |.|...|.:...:...||       .::..|..|..   |..|..
  Rat   507 PR--VCDRQPDCLNGSDEEQCQEGVPCGTFTFQCEDRS-------CVKKPNPECDG---QADCRD 559

  Fly   219 GQGITNTTPAPSQIVPKNTDEIPRRLLNVEEGCGSTV-GYFKKIVGGEVSRKGAWPWIALLGYDD 282
            |..                          ||.|...: |...:||||.:|.:|.|||.|.|   .
  Rat   560 GSD--------------------------EEHCDCGLQGPSSRIVGGAMSSEGEWPWQASL---Q 595

  Fly   283 PSGSPFKCGGTLITARHVLTAAHCIRQD------LQFVRLGEHDLSTDTETGHVDINIARYVSHP 341
            ..|... |||.||..|.|:|||||.::|      |..|.||:. .......|.|...::|...||
  Rat   596 IRGRHI-CGGALIADRWVITAAHCFQEDSMASPRLWTVFLGKM-RQNSRWPGEVSFKVSRLFLHP 658

  Fly   342 DYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVL 406
            .:...:...|:|:|.|:..|.:::.:.|:|||..::..:.   |...::.|||...|||..:..|
  Rat   659 YHEEDSHDYDVALLQLDHPVVYSATVRPVCLPARSHFFEP---GQHCWITGWGAQREGGPGSSTL 720

  Fly   407 NELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLR 471
            .::.:.:....:|.::|    ||    |....:||||...|.||.|||||||||:..|| .|  |
  Rat   721 QKVDVQLIPQDLCNEAY----RY----QVTPRMLCAGYRKGKKDACQGDSGGPLVCKEP-SG--R 774

  Fly   472 FYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQV 507
            ::|.|:||:|:||.|||..|||:.....::| ||||
  Rat   775 WFLAGLVSWGLGCGRPNFFGVYTRVTRVVNW-IQQV 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 13/56 (23%)
Tryp_SPc 260..503 CDD:214473 89/248 (36%)
Tryp_SPc 261..503 CDD:238113 89/247 (36%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060 8/19 (42%)
Ldl_recept_a 529..566 CDD:278486 10/72 (14%)
Tryp_SPc 576..806 CDD:214473 90/249 (36%)
Tryp_SPc 577..809 CDD:238113 92/251 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.