DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Tmprss9

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:382 Identity:115/382 - (30%)
Similarity:159/382 - (41%) Gaps:69/382 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TPRTTTTTTTTTPAPIPDTSAAPLIEPRGTVCRGPDTKPGNCVEIKECASLLNELRSRSQDATFA 197
            |....|::|...|:..|.|:||.||         |:...|               |..:..||..
  Rat   778 TAHPHTSSTRLIPSQPPTTTAAGLI---------PEASTG---------------RPATLRATIR 818

  Fly   198 NFLRASNAVCQNKGTQVCCPTGQGITNTTPAPSQIVPKNTDEIPRRLLNVEEGCG-STVGYFKKI 261
            ...|..|.....:.|..        ...||||...|..:..:           || :..|...:|
  Rat   819 VTTRPLNTTLSARSTTT--------RRQTPAPGTTVFSHLPD-----------CGLAPPGALTRI 864

  Fly   262 VGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI---RQDLQFVR-LGEHDLS 322
            |||..:..|.|||...|..   .....:||..|:..|.:|:||||.   ...:|:.. ||...||
  Rat   865 VGGSAASLGEWPWQVSLWL---RRREHRCGAVLVAERWLLSAAHCFDVYGDPMQWAAFLGTPFLS 926

  Fly   323 TDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYM 387
            : || |.:: .:||...||.||......|:|:|.|...|..:..:.|||||......:    |..
  Rat   927 S-TE-GQLE-RVARIYRHPFYNIYTLDYDVALLELAGPVRRSRLVRPICLPGPTRPPE----GAR 984

  Fly   388 PFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTC 452
            ..:.|||...|||..|:.|.:..:.:...:.|        |.|...|....:||||...||.|:|
  Rat   985 CVITGWGSLREGGSMARQLQKAAVRVLSEQTC--------RRFYPVQISSRMLCAGFPQGGVDSC 1041

  Fly   453 QGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQVQD 509
            .||:||||...|| .||  :.|.||.|:|.||.||:.||||:.....:.||.|.:::
  Rat  1042 SGDAGGPLACREP-SGQ--WVLTGVTSWGYGCGRPHFPGVYTRVAAVLGWIGQNIRE 1095

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 8/51 (16%)
Tryp_SPc 260..503 CDD:214473 86/246 (35%)
Tryp_SPc 261..503 CDD:238113 86/245 (35%)
Tmprss9NP_001382445.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.