DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Prss30

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:304 Identity:100/304 - (32%)
Similarity:147/304 - (48%) Gaps:49/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 TTPAPSQIVPKNT----------------DEIPRRLLNVEEGCGSTVGYFK---KIVGGEVSRKG 270
            :||.|..||...|                |.:|           |..|:.:   |||||:.:.:|
Mouse    30 STPHPQWIVDGLTLRRSYAGFFYNGWARGDILP-----------SVCGHSRDAGKIVGGQDALEG 83

  Fly   271 AWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQ----FVRLGEHDLSTDTETGHVD 331
            .|||...|...:..   ..|||:||....|||||||.|:.|.    .|::|...||. .|.....
Mouse    84 QWPWQVSLWITEDG---HICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGLTLSL-LEPHSTL 144

  Fly   332 INIARYVSHPDYNRRNGRS-DMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGK 395
            :.:.....||.|...:..| |:|::.|:..:. .|:..|:|||..   :.....|.:.:|.|||.
Mouse   145 VAVRNIFVHPTYLWADASSGDIALVQLDTPLR-PSQFTPVCLPAA---QTPLTPGTVCWVTGWGA 205

  Fly   396 TMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKA-VLCAGVLSGGKDTCQGDSGGP 459
            |.| .:.|.||.||.:|:.|::.|.:.|..:....|.::..:: :||||.:.|.||:||||||||
Mouse   206 TQE-RDMASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAGYVEGQKDSCQGDSGGP 269

  Fly   460 LMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI 503
            |:.    .....:..:|:.|:|||||||..||||:....::|||
Mouse   270 LVC----SINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 88/248 (35%)
Tryp_SPc 261..503 CDD:238113 87/247 (35%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 89/249 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.