DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and GZMH

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens


Alignment Length:260 Identity:77/260 - (29%)
Similarity:123/260 - (47%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 GCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFV 314
            |.|:     ::|:||..::..:.|::|.:.:.... |..:|||.|:....|||||||....:. |
Human    15 GAGT-----EEIIGGHEAKPHSRPYMAFVQFLQEK-SRKRCGGILVRKDFVLTAAHCQGSSIN-V 72

  Fly   315 RLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLR 379
            .||.|::.....|... |.:.|.:.||.||.:|..:|:.:|.|||..::|:.:.|:.||.:    
Human    73 TLGAHNIKEQERTQQF-IPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSS---- 132

  Fly   380 QKSYV--GYMPFVAGWG----KTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKA 438
             |:.|  |.:..|||||    .|:     |..|.|:.:.:..:..|       :|.|..:.....
Human   133 -KAQVKPGQLCSVAGWGYVSMSTL-----ATTLQEVLLTVQKDCQC-------ERLFHGNYSRAT 184

  Fly   439 VLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI 503
            .:|.|.....:...:|||||||:..:..|        |::|||.....|  ||||....:|:.||
Human   185 EICVGDPKKTQTGFKGDSGGPLVCKDVAQ--------GILSYGNKKGTP--PGVYIKVSHFLPWI 239

  Fly   504  503
            Human   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 73/248 (29%)
Tryp_SPc 261..503 CDD:238113 73/247 (30%)
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 75/249 (30%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.