DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and F2

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_075213.2 Gene:F2 / 29251 RGDID:61996 Length:617 Species:Rattus norvegicus


Alignment Length:608 Identity:150/608 - (24%)
Similarity:219/608 - (36%) Gaps:173/608 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QRRQVRQNCITPENYYGSCVALTYCPQVVNIFQT------TSRDRAQRYVIALQRSC-------- 79
            ::..:.:.|:..:..|.........||..::|..      :.|...:.::..|:..|        
  Rat    53 RKGNLERECVEEQCSYEEAFEALESPQDTDVFWAKYTVCDSVRKPRETFMDCLEGRCAMDLGLNY 117

  Fly    80 -GTRSINGDPVICCT-------EPRYNPVTERP---------RNPFFPSESTFIGP---QPPPEV 124
             |..|:....:.|..       .|..|..| .|         |||    :|:..||   ...|.|
  Rat   118 HGNVSVTHTGIECQLWRSRYPHRPDINSTT-HPGADLKENFCRNP----DSSTSGPWCYTTDPTV 177

  Fly   125 PDNPFLIP------------TPRTTTTTTTTTPAPIPD----------------TSAAPLIE--- 158
            ......||            |||:..:....:| |:.:                |..:|.:.   
  Rat   178 RREECSIPVCGQEGRTTVKMTPRSRGSKENLSP-PLGECLLERGRLYQGNLAVTTLGSPCLAWDS 241

  Fly   159 -PRGTV----------------CRGPD-----------TKPG-NCVEIKECASLLNE-------- 186
             |..|:                ||.||           .:|| ....:..|...:.|        
  Rat   242 LPTKTLSKYQNFDPEVKLVQNFCRNPDRDEEGAWCFVAQQPGFEYCSLNYCDEAVGEENHDGDES 306

  Fly   187 LRSRSQDATFANFLRASNAVCQNKGTQVCCPTGQGITNTTPAPSQIVPKNTDEIPRRLLNVEEGC 251
            :..|:.||.|..|.....             .|.|..:....|.......||:..:.||:     
  Rat   307 IAGRTTDAEFHTFFDERT-------------FGLGEADCGLRPLFEKKSLTDKTEKELLD----- 353

  Fly   252 GSTVGYFK-KIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI-------- 307
                .|.. :||.|..:.||..||..:|....|  ....||.:||:.|.||||||||        
  Rat   354 ----SYIDGRIVEGWDAEKGIAPWQVMLFRKSP--QELLCGASLISDRWVLTAAHCILYPPWDKN 412

  Fly   308 --RQDLQFVRLGEHDLSTDTETGHVDINIAR--YVSHPDYN-RRNGRSDMAILYLERNVEFTSKI 367
              ..|| .||:|:|. .|..|.....|::..  |: ||.|| |.|...|:|:|.|::.|.|:..|
  Rat   413 FTENDL-LVRIGKHS-RTRYERNVEKISMLEKIYI-HPRYNWRENLDRDIALLKLKKPVPFSDYI 474

  Fly   368 APICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQ--------IPIYDNKVCVQSYA 424
            .|:|||....:......||...|.|||...|...:.  :||:|        :||.:..||..|  
  Rat   475 HPVCLPDKQTVTSLLQAGYKGRVTGWGNLRETWTTN--INEIQPSVLQVVNLPIVERPVCKAS-- 535

  Fly   425 KEKRYFSADQFDKAVLCAGV-LSGGK--DTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCAR 486
              .|....|.    :.|||. ::..|  |.|:||||||.::..||..  |:|.:|:||:|.||.|
  Rat   536 --TRIRITDN----MFCAGFKVNDTKRGDACEGDSGGPFVMKSPYNH--RWYQMGIVSWGEGCDR 592

  Fly   487 PNVPGVYSSTQYFMDWIIQQVQD 509
            ....|.|:.......| :|:|.|
  Rat   593 NGKYGFYTHVFRLKRW-MQKVID 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829 11/70 (16%)
CLIP 164..216 CDD:288855 13/71 (18%)
Tryp_SPc 260..503 CDD:214473 91/266 (34%)
Tryp_SPc 261..503 CDD:238113 91/265 (34%)
F2NP_075213.2 GLA 25..89 CDD:214503 5/35 (14%)
KR 107..189 CDD:214527 18/86 (21%)
Kringle 215..292 CDD:278480 10/76 (13%)
Thrombin_light 312..359 CDD:286482 12/68 (18%)
Tryp_SPc 359..608 CDD:214473 91/265 (34%)
Tryp_SPc 360..612 CDD:238113 93/269 (35%)
High affinity receptor-binding region which is also known as the TP508 peptide 547..569 11/21 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.