DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and F10

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:423 Identity:120/423 - (28%)
Similarity:181/423 - (42%) Gaps:106/423 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 GTVCR-GPDTKPGNC--------------VEIKECASLLNELRS-----------RSQDATFAN- 198
            |..|. .|....|.|              .|.|.|...:.:|.|           ..|::...: 
  Rat    87 GDQCESSPCQNQGECRDGLGSYTCTCTEGFEGKNCELFVRKLCSLDNGDCDQFCREEQNSVVCSC 151

  Fly   199 ----FLRASNAVCQNKGTQVCCPTGQG---------ITNTTPAPSQIVPKNTD-----EIPRRLL 245
                ||......|.:.....|..|.:|         .:|:.|.|..::| :.|     |.|..||
  Rat   152 AKGYFLGNDGKSCLSTAPFPCGKTNKGRAKRSVALNTSNSEPDPEDLMP-DADILYPTESPSELL 215

  Fly   246 NV-----EEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAH 305
            |:     |......:    :||||:..::|..||.||| :.|.....| ||||::...::|||||
  Rat   216 NLNKTEPEANSDDVI----RIVGGQECKRGECPWQALL-FSDEETDGF-CGGTILNEFYILTAAH 274

  Fly   306 CIRQDLQF-VRLGEHDLSTDTETG-----HVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFT 364
            |:.|..:| ||:|  ||:|:.|.|     .||:    .:.|..:.|.....|:|:|.|:..:.|.
  Rat   275 CLHQAKRFKVRVG--DLNTEQEDGGEMVHEVDM----IIKHNKFQRDTYDFDIAMLRLKTPITFR 333

  Fly   365 SKIAPICLP-----HTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYA 424
            ..:||.|||     ....:.||:.:     |:|:|:|.|.|..::||..:::|..|...|..|.:
  Rat   334 ENVAPACLPQKDWAEATLMTQKTGI-----VSGFGRTHEKGRQSKVLKMMEVPYVDRNTCRLSTS 393

  Fly   425 KEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRF----YLIGVVSYGIGCA 485
                 ||..|   .:.|||..:..:|.||||||||.:        .||    ::.|:||:|.|||
  Rat   394 -----FSITQ---NMFCAGYDAKQEDACQGDSGGPHV--------TRFKDTYFVTGIVSWGEGCA 442

  Fly   486 RPNVPGVYSSTQYFMDWI-------IQQVQDTP 511
            |....|:|:....|:.||       :....:||
  Rat   443 RKGKYGIYTKVTAFLKWIDRSMKARVGPTSETP 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 13/82 (16%)
Tryp_SPc 260..503 CDD:214473 88/257 (34%)
Tryp_SPc 261..503 CDD:238113 88/256 (34%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011 7/34 (21%)
FXa_inhibition 129..164 CDD:405372 4/34 (12%)
Tryp_SPc 232..462 CDD:238113 90/258 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.