DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Prss34

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:325 Identity:96/325 - (29%)
Similarity:148/325 - (45%) Gaps:75/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 TTPAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFK 289
            |.|.....:|...|. .:.|:.:..||..:...|              ||...|.:.:...|.::
  Rat    12 TLPCLGSTMPLTPDS-GQELVGIVGGCPVSASRF--------------PWQVSLRFYNMKLSKWE 61

  Fly   290 --CGGTLITARHVLTAAHCI----------RQDLQFVRLGEHDLSTDTETGHVDINIARYVSHPD 342
              |||:||..:.|||||||:          |..:..:||.|:|..         :.:|:.:.||.
  Rat    62 HICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQL---------MKVAKIIRHPK 117

  Fly   343 YNRR---NGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQ 404
            ::.:   .|.:|:|:|.|:..|..:.::.|:.|| .|:.|..|...:  :||||| .:||.....
  Rat   118 FSEKLSAPGGADIALLKLDSTVVLSERVHPVSLP-AASQRISSKKTW--WVAGWG-VIEGHRPLP 178

  Fly   405 V---LNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAV----LCAGVLSGGKDTCQGDSGGPLML 462
            .   |.|:.:||..|..|.|.|   :.|.|.|:..|.:    ||||:  .|:|:||.||||||:.
  Rat   179 PPCHLREVAVPIVGNSDCEQKY---RTYSSLDRTTKIIKDDMLCAGM--EGRDSCQADSGGPLVC 238

  Fly   463 PEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI----------------IQQVQDTP 511
                :....:..:||||:||||..|:.||||:....::.||                |...:|||
  Rat   239 ----RWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWIHGYVPKFPEPSMGPDRIHTPEDTP 299

  Fly   512  511
              Rat   300  299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 82/264 (31%)
Tryp_SPc 261..503 CDD:238113 82/263 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 86/278 (31%)
Tryp_SPc 33..275 CDD:214473 85/277 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.