DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG33226

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:290 Identity:87/290 - (30%)
Similarity:130/290 - (44%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 VEEGCGST-VGYFKKIVGGEVSRKGAWPWIALL---GYDDPSGSPFKCGGTLITARHVLTAAHCI 307
            ::..|..| ||..::|:||..:.....||:..:   ||       ..|||:||::..|||||||.
  Fly    32 LDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGY-------HFCGGSLISSLFVLTAAHCH 89

  Fly   308 RQDLQFVRLGEHDLSTD---------TETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEF 363
            .:....||.|.:...|.         :..| .:|::.|...|..| |.....|:|:..|.:.|.:
  Fly    90 SRYRLKVRFGRYSGITPRYLCSSQYCSPFG-PEIDVKRIFLHSSY-RDYHNYDIALFLLAKPVRY 152

  Fly   364 TSKIAPICLPHTAN---LRQKSYVGYMPF--VAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSY 423
            ..:..|||:..|:|   |||  ::.|:..  |.||||| |...::.:|....:...|.|.|.|. 
  Fly   153 NVQTRPICVLQTSNKDKLRQ--FLNYVAMFNVTGWGKT-ESQLTSTILQTTSLFHLDRKFCAQI- 213

  Fly   424 AKEKRYFSADQFDKAV----LCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGC 484
                       ||:.:    :|||  .....||.|||||||.....:.|..|..|.|::|||   
  Fly   214 -----------FDRKIGWPHICAG--HSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYG--- 262

  Fly   485 ARPNV--PGVYSSTQYFMDWIIQQVQD-TP 511
             .||.  ..|:::...:.:||...|.: ||
  Fly   263 -APNCREVTVFTNVLRYSNWIRDIVHNFTP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 78/265 (29%)
Tryp_SPc 261..503 CDD:238113 78/264 (30%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 80/267 (30%)
Tryp_SPc 47..282 CDD:214473 78/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.