DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG30083

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:277 Identity:91/277 - (32%)
Similarity:132/277 - (47%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 VEEGCGSTVGYFKKIVGGEVSRKGAWPWIA-LLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQD 310
            :|..||.. ....||:.|:.:..|..||:| :..|:|...:...||||||..:.||:|||||::|
  Fly    21 LEPNCGYP-DISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRD 84

  Fly   311 -LQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICL-- 372
             :..||||||..|..........|  :|.:...|:     :|:.||.::..|:|.:.|.|||:  
  Fly    85 QILAVRLGEHSSSRYFAVTKAFRN--KYFTTGSYS-----NDIGILRIQPIVKFNAVIRPICIIT 142

  Fly   373 -----PHTANLRQKSYVGYMPFVAGWGKTMEGGESAQV-----LNELQIPIYDNKVCVQSYAKEK 427
                 |:....:          .|||||| |....::|     ||||......|.:.|       
  Fly   143 DPTKVPNVKTFK----------AAGWGKT-ENETFSKVLKTVELNELNASECYNMLWV------- 189

  Fly   428 RYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGV 492
                  ...::.:|||...|  |||.|||||||:.|....|.||:..:|::|:|....  |.|||
  Fly   190 ------NVTESQICAGHPDG--DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC--NSPGV 244

  Fly   493 YSSTQYFMDWIIQQVQD 509
            |:....|:|||:..|.:
  Fly   245 YTRLSSFIDWILMVVDN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 85/256 (33%)
Tryp_SPc 261..503 CDD:238113 84/255 (33%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 85/256 (33%)
Tryp_SPc 34..255 CDD:238113 84/255 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.