DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CG30025

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster


Alignment Length:272 Identity:87/272 - (31%)
Similarity:133/272 - (48%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 IPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPW-IALLGYDDPSGSPFKCGGTLITARHVLTA 303
            :|..||...:|         :||||..:...::|| |:|    ..||| ..|||::.::..::||
  Fly    19 VPEGLLPQLDG---------RIVGGSATTISSFPWQISL----QRSGS-HSCGGSIYSSNVIVTA 69

  Fly   304 AHCIRQ---DLQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTS 365
            |||::.   .:..:|.|    |:...:|.|..:::.:.:|..||.....:|:||:.:...:.|:|
  Fly    70 AHCLQSVSASVLQIRAG----SSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSS 130

  Fly   366 KIAPICL--PHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDN-KVCVQSYAKEK 427
            .|..|.|  .:.||       |....|:|||....|  |:.:.::||   |.| .:..||.....
  Fly   131 TIKAIGLASSNPAN-------GAAASVSGWGTLSYG--SSSIPSQLQ---YVNVNIVSQSQCASS 183

  Fly   428 RYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGV 492
            .|....|....::||.  :.|||.|||||||||:     .|.:   |:||||:|.|||..|.|||
  Fly   184 TYGYGSQIRSTMICAA--ASGKDACQGDSGGPLV-----SGGV---LVGVVSWGYGCAYSNYPGV 238

  Fly   493 YSSTQYFMDWII 504
            |:.......|:|
  Fly   239 YADVAALRSWVI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 81/249 (33%)
Tryp_SPc 261..503 CDD:238113 81/248 (33%)
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 81/249 (33%)
Tryp_SPc 31..252 CDD:238113 83/251 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.