DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and TPSD1

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:212 Identity:69/212 - (32%)
Similarity:104/212 - (49%) Gaps:24/212 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 IVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQ-----FVRLGEHD 320
            ||||:.:.:..|||...|....|....| |||:||..:.|||||||:..|::     .|:|.|..
Human    38 IVGGQEAPRSKWPWQVSLRVRGPYWMHF-CGGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQH 101

  Fly   321 LSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVG 385
            |....:.    :.::|.:.||.:......:|:|:|.||..|..:|.|..:.||..:    :::..
Human   102 LYYQDQL----LPVSRIIVHPQFYIIQTGADIALLELEEPVNISSHIHTVTLPPAS----ETFPP 158

  Fly   386 YMP-FVAGWGKTMEGGE--SAQVLNELQIPIYDNKVCVQSY---AKEKRYFSADQFDKAVLCAGV 444
            .|| :|.|||.......  ....|.|:::|:.:|.:|...|   ......|...:.|  :|||| 
Human   159 GMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDD--MLCAG- 220

  Fly   445 LSGGKDTCQGDSGGPLM 461
             |...|:|||||||||:
Human   221 -SENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 69/212 (33%)
Tryp_SPc 261..503 CDD:238113 69/212 (33%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 69/212 (33%)
Tryp_SPc 38..240 CDD:214473 69/212 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.