DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Prss39

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_033381.1 Gene:Prss39 / 21755 MGIID:1270856 Length:367 Species:Mus musculus


Alignment Length:368 Identity:97/368 - (26%)
Similarity:160/368 - (43%) Gaps:84/368 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GPDTKPGNCV--EIKECASLLNELRSRSQDATFANFLRASNAVCQNKGTQVCCPTGQGITNTTPA 228
            ||| :.|.|:  ....|.|||:     :||.|                                 
Mouse    10 GPD-RGGACLLAAFLLCFSLLH-----AQDYT--------------------------------- 35

  Fly   229 PSQIVP--KNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFK-- 289
            |||..|  .||...||..:. :|.||.| .:..||.||::::...|||.|.|        .|:  
Mouse    36 PSQTPPPTSNTSLKPRGRVQ-KELCGKT-KFQGKIYGGQIAKAERWPWQASL--------IFRGR 90

  Fly   290 --CGGTLITARHVLTAAHCIRQDL----QFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNG 348
              ||..||....:|:||||.::.|    ..:.||.:.||..:.... .:.:.:.:.|.||::.:.
Mouse    91 HICGAVLIDKTWLLSAAHCFQRSLTPSDYRILLGYNQLSNPSNYSR-QMTVNKVILHEDYSKLSR 154

  Fly   349 -RSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIP 412
             ..::.::.|...|.:::.|.|.|:|....   |.....:.:::|||..     ||....:...|
Mouse   155 LEKNIVLIQLHHPVIYSTHIFPACVPDGTT---KVSPNNLCWISGWGML-----SADKFLQAPFP 211

  Fly   413 IYDNKVCVQSYAKEKRYF-----SADQFD---KAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQ 469
            :.|.:|.:....:...:|     |..::|   ..|||||.|:..|.:|:|||||||:.   :...
Mouse   212 LLDAEVSLIDEEECTTFFQTPEVSITEYDVIKDDVLCAGDLTNQKSSCRGDSGGPLVC---FLNS 273

  Fly   470 LRFYLIGVVSYGIGCARP-NVPGVYSSTQYFMDWIIQQVQDTP 511
            . :|::|:.::...|..| :.|.:::...||.|||.|:..:||
Mouse   274 F-WYVVGLANWNGACLEPIHSPNIFTKVSYFSDWIKQKKANTP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 12/51 (24%)
Tryp_SPc 260..503 CDD:214473 68/260 (26%)
Tryp_SPc 261..503 CDD:238113 67/259 (26%)
Prss39NP_033381.1 Tryp_SPc 67..307 CDD:214473 68/260 (26%)
Tryp_SPc 68..310 CDD:238113 69/262 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.