DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and F9

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:285 Identity:90/285 - (31%)
Similarity:148/285 - (51%) Gaps:36/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 NTDEIPRRLLNVEEGCGSTVGY--FKKIVGGEVSRKGAWPW-IALLGYDDPSGSPFKCGGTLITA 297
            |:.|....|.|:.:   ||..:  |.::||||.::.|.:|| :.|.|..|..     |||:::..
Human   203 NSTEAETILDNITQ---STQSFNDFTRVVGGEDAKPGQFPWQVVLNGKVDAF-----CGGSIVNE 259

  Fly   298 RHVLTAAHCIRQDLQF-VRLGEHDLSTDTETGHVD--INIARYVSHPDYNRRNGR--SDMAILYL 357
            :.::|||||:...::. |..|||::.   ||.|.:  .|:.|.:.|.:||....:  .|:|:|.|
Human   260 KWIVTAAHCVETGVKITVVAGEHNIE---ETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLEL 321

  Fly   358 ERNVEFTSKIAPICL--PHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCV 420
            :..:...|.:.|||:  ....|:..|...||   |:|||:....|.||.||..|::|:.|...|:
Human   322 DEPLVLNSYVTPICIADKEYTNIFLKFGSGY---VSGWGRVFHKGRSALVLQYLRVPLVDRATCL 383

  Fly   421 QSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCA 485
            :| .|...|       ..:.|||...||:|:||||||||.:.    :.:...:|.|::|:|..||
Human   384 RS-TKFTIY-------NNMFCAGFHEGGRDSCQGDSGGPHVT----EVEGTSFLTGIISWGEECA 436

  Fly   486 RPNVPGVYSSTQYFMDWIIQQVQDT 510
            .....|:|:....:::||.::.:.|
Human   437 MKGKYGIYTKVSRYVNWIKEKTKLT 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 80/250 (32%)
Tryp_SPc 261..503 CDD:238113 80/249 (32%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:317114
Tryp_SPc 227..457 CDD:238113 82/252 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.