DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and PRSS55

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:320 Identity:93/320 - (29%)
Similarity:151/320 - (47%) Gaps:54/320 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 TGQGITNTTPAPSQIVP-------KNTDEIPRRLLNVEEGCGSTVGY-----FKKIVGGEVSRKG 270
            ||..:...||.|...|.       .:..:.|.....|.| ||....:     :.:|.||..:..|
Human    14 TGTQLGPRTPLPEAGVAILGRARGAHRPQPPHPPSPVSE-CGDRSIFEGRTRYSRITGGMEAEVG 77

  Fly   271 AWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQF-----VRLGEHDLSTDTETGHV 330
            .:||...:   .....|| |||:::....:||||||:..:..|     |.||.:||::.:    :
Human    78 EFPWQVSI---QARSEPF-CGGSILNKWWILTAAHCLYSEELFPEELSVVLGTNDLTSPS----M 134

  Fly   331 DI-NIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICL---PHTANLRQKSYVGYMPFVA 391
            :| .:|..:.|.|:.|.|..:|:|:|.|...::......||||   |..|..|:       .:||
Human   135 EIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQPGPATWRE-------CWVA 192

  Fly   392 GWGKTMEGGESAQVLNELQIP--IYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQG 454
            |||:|....:::...:.::.|  |.|.:.|.:.:.|         ..|.:||||..:...|.|:|
Human   193 GWGQTNAADKNSVKTDLMKAPMVIMDWEECSKMFPK---------LTKNMLCAGYKNESYDACKG 248

  Fly   455 DSGGPLM-LPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI--IQQVQDTP 511
            ||||||: .|||.:   ::|.:|::|:|..|...|.||:|:|...:..||  :.|::..|
Human   249 DSGGPLVCTPEPGE---KWYQVGIISWGKSCGEKNTPGIYTSLVNYNLWIEKVTQLEGRP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 78/254 (31%)
Tryp_SPc 261..503 CDD:238113 78/253 (31%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 78/254 (31%)
Tryp_SPc 68..298 CDD:238113 80/256 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.