DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Proc

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006525784.1 Gene:Proc / 19123 MGIID:97771 Length:484 Species:Mus musculus


Alignment Length:391 Identity:110/391 - (28%)
Similarity:175/391 - (44%) Gaps:72/391 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 DTSAAPLIEPRGTVCRGPDTKPGNCV--------------EIKECASLLNELRSRSQDATFANFL 200
            |..:||   |....|..|....|.|:              |.|.|...|     |.||.      
Mouse   113 DQCSAP---PLDHQCDSPCCGHGTCIDGIGSFSCSCDKGWEGKFCQQEL-----RFQDC------ 163

  Fly   201 RASNAVC------QNKGTQVCCPTGQGITNTTPAPSQIVPKNTDEIP-----------RRLLNVE 248
            |.:|..|      ::.|.:..|..|..:     |...:..|:|...|           |::|..:
Mouse   164 RVNNGGCLHYCLEESNGRRCACAPGYEL-----ADDHMRCKSTVNFPCGKLGRWIEKKRKILKRD 223

  Fly   249 EGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQF 313
            ......:....:||.|.::::|..||.|:| .|  |.....|||.||....|||||||:....:.
Mouse   224 TDLEDELEPDPRIVNGTLTKQGDSPWQAIL-LD--SKKKLACGGVLIHTSWVLTAAHCVEGTKKL 285

  Fly   314 -VRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTAN 377
             |||||:||.. .:...:|::|...:.||:|.|.:..:|:|:|.|.:....:..|.|||||:...
Mouse   286 TVRLGEYDLRR-RDHWELDLDIKEILVHPNYTRSSSDNDIALLRLAQPATLSKTIVPICLPNNGL 349

  Fly   378 LRQKSYVGYMPFVAGWG----KTMEGGESAQ-VLNELQIPIYDNKVCVQSYAKEKRYFSADQFDK 437
            .::.:..|....|.|||    :..:|..:.. :|..::||:.....||:..   |...|.:    
Mouse   350 AQELTQAGQETVVTGWGYQSDRIKDGRRNRTFILTFIRIPLVARNECVEVM---KNVVSEN---- 407

  Fly   438 AVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDW 502
             :||||::...:|.|.||||||:::  .::|  .::|:|:||:|.||...|..|:|:....::.|
Mouse   408 -MLCAGIIGDTRDACDGDSGGPMVV--FFRG--TWFLVGLVSWGEGCGHTNNYGIYTKVGSYLKW 467

  Fly   503 I 503
            |
Mouse   468 I 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 15/71 (21%)
Tryp_SPc 260..503 CDD:214473 81/248 (33%)
Tryp_SPc 261..503 CDD:238113 81/247 (33%)
ProcXP_006525784.1 GLA 50..110 CDD:214503
EGF_CA 111..155 CDD:238011 10/44 (23%)
FXa_inhibition 163..198 CDD:373209 7/45 (16%)
Tryp_SPc 236..470 CDD:238113 83/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.