DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and F25E5.4

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001379698.1 Gene:F25E5.4 / 179133 WormBaseID:WBGene00017785 Length:425 Species:Caenorhabditis elegans


Alignment Length:340 Identity:70/340 - (20%)
Similarity:114/340 - (33%) Gaps:108/340 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 DEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPW---IALLGYDDPSGSPFKCGGTLITARH 299
            ||....:|.::  || ..|..::.:.|:.:|.|..||   :.:..........|...||||:|||
 Worm    21 DEKHNEILQLK--CG-IKGSQREFINGDTARPGDHPWAVSVYVKANTTSKNGVFLGPGTLISARH 82

  Fly   300 VLTAAHCIRQDLQFVRLGEHDLSTDTETGHVDINIARYVSHPDY---------NRRNGRSDMAIL 355
            |||.......|.:...||:.:::......|.::: ...:.|.||         ::|:.::.:|.:
 Worm    83 VLTFNSIKVVDGKRRILGQEEVNGACNGNHFELS-QDEMYHFDYDFEHFKNFDSKRDFKNTIASV 146

  Fly   356 YLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNK--- 417
            |:....:.:        |..|.|                          ::.||:.....||   
 Worm   147 YIINGCQSS--------PPPATL--------------------------LMFELKESALHNKKGY 177

  Fly   418 -VCVQSYAKEKRYFSADQFDKAVL-----------------------CAGVLSGGKDTCQGDSGG 458
             ||:.:..|   :|.|..|:...|                       ||..:...:..|.||.||
 Worm   178 PVCISNSPK---HFDASDFEVFGLNQQGRLVSGAFAPTNCTATAPFSCAHAVKQNQGLCSGDFGG 239

  Fly   459 P---------LML-------------PEPYQGQLRFYLIGVVSYGI----GCARPNVPGVYSSTQ 497
            .         .||             ||..:. .:|..||.....|    |...|:.|....||.
 Worm   240 SAVSRIDNRFTMLGFFAQGNKNCKAKPETLEA-FKFLNIGYYREEICEVTGICTPSPPSPEESTT 303

  Fly   498 YFMDWIIQ-QVQDTP 511
            .....:|. :..|||
 Worm   304 LSPSELIPGESTDTP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 60/307 (20%)
Tryp_SPc 261..503 CDD:238113 60/306 (20%)
F25E5.4NP_001379698.1 DUF316 5..291 CDD:367641 62/311 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.