DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and Mcpt2

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_032597.1 Gene:Mcpt2 / 17225 MGIID:96938 Length:244 Species:Mus musculus


Alignment Length:260 Identity:72/260 - (27%)
Similarity:126/260 - (48%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQ 309
            |.:..|.|:     ::|:||..::..:.|::|.|.:...:||..:|||.||..:.|:|||||...
Mouse    10 LLLPSGAGA-----EEIIGGVEAKPHSRPYMAYLKFTTKNGSKERCGGFLIAPQFVMTAAHCNGS 69

  Fly   310 DLQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPH 374
            ::..: ||.|:::.:..|..: |...:...||.:...:|..|:.:|.|::..|..|.:..|.||.
Mouse    70 EISVI-LGAHNINKNEPTQQI-IKTEKTFVHPKFQYLSGFYDIMLLKLQKKAELNSDVDVISLPS 132

  Fly   375 TANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAV 439
            :::..:.   |.|.:.||||||.:....:..|.|:::.|.|.:.|..         .:|...:..
Mouse   133 SSDFIKP---GKMCWTAGWGKTGKNNPLSVTLREVELRIMDQEACKD---------HSDYDYQLQ 185

  Fly   440 LCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCA-RPNVPGVYSSTQYFMDWI 503
            :|||..:..|...||||||||:...             |::||..: ....|.|::...|::.||
Mouse   186 VCAGSPTTSKSIGQGDSGGPLVCDS-------------VAHGIASSYEAKAPAVFTRISYYLPWI 237

  Fly   504  503
            Mouse   238  237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 67/243 (28%)
Tryp_SPc 261..503 CDD:238113 67/242 (28%)
Mcpt2NP_032597.1 Tryp_SPc 20..237 CDD:214473 67/243 (28%)
Tryp_SPc 21..240 CDD:238113 69/244 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.