DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP001244

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_321898.3 Gene:AgaP_AGAP001244 / 1281920 VectorBaseID:AGAP001244 Length:279 Species:Anopheles gambiae


Alignment Length:300 Identity:84/300 - (28%)
Similarity:131/300 - (43%) Gaps:60/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 VCCPTGQGITNTTPAPS-----QIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGE-VSRKGAW 272
            |.|.....:.:.....|     :::|....::..|   .::..|| ||..||||||| ||.:...
Mosquito     6 VICAVALAVASAQDVASTVYGRRMLPAGAQQVDDR---AQQSMGS-VGSLKKIVGGEPVSIETHV 66

  Fly   273 PWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVRLGEHDLSTDTETGHVDINIARY 337
            ..::|..||     ...||.::|::...||||||:..|.....:.....:....||....|..|.
Mosquito    67 YQLSLRSYD-----YHICGASIISSVWALTAAHCLFPDPDPRTISLLAGTGSQSTGGRIYNATRI 126

  Fly   338 VSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMP-----------FVA 391
            :.||.|......:|:|::.:  |..|:.       |:|      .|:|.:|           .|.
Mosquito   127 IIHPMYAPSTMDNDVAVIRV--NTHFSG-------PNT------GYIGVVPLGYEPMAGVRAIVT 176

  Fly   392 GWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDS 456
            |||:..||.:.:..|..::|||.|...|:..:       |.......::|||.|  |||:|.|||
Mosquito   177 GWGRQSEGAKQSMTLAGVEIPIVDKAECMDQW-------SGVLVSPQMICAGEL--GKDSCNGDS 232

  Fly   457 GGPLMLPEPYQGQLRFYLIGVVSYG-IGCARPNVPGVYSS 495
            ||||:     .|..:   ||:||:| ..|..| :..:|::
Mosquito   233 GGPLV-----SGGRQ---IGIVSWGSTKCGGP-LAAIYTN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 1/1 (100%)
Tryp_SPc 260..503 CDD:214473 74/248 (30%)
Tryp_SPc 261..503 CDD:238113 73/247 (30%)
AgaP_AGAP001244XP_321898.3 Tryp_SPc 53..266 CDD:214473 74/248 (30%)
Tryp_SPc 54..276 CDD:238113 73/247 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.