DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CLIPB15

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_318957.5 Gene:CLIPB15 / 1279262 VectorBaseID:AGAP009844 Length:364 Species:Anopheles gambiae


Alignment Length:367 Identity:113/367 - (30%)
Similarity:175/367 - (47%) Gaps:64/367 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 GTVCRGPDTKPGNCVEIKECASLLNELRS---RSQDATFANFLRASNAVCQNKGTQV---CCPTG 219
            |..|:.|....|.|..:|.|:.:...|:|   ...|.|:.:.|:..:.:...:...:   |||. 
Mosquito    28 GDPCQTPSGTAGTCEPVKNCSYVRKILKSPDFSHYDTTYLDTLKCGDLMVPMRKKPIPLLCCPK- 91

  Fly   220 QGITNTTPAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYD-DP 283
              .:|:....:|       ::..|:            ||     ||.:.:||.||.|||.|: ..
Mosquito    92 --FSNSPTCGAQ-------QLADRI------------YF-----GEETERGAHPWAALLFYNVGR 130

  Fly   284 SGSPFKCGGTLITARHVLTAAHCI----RQDLQFVRLGEHDLST----DTETGHV----DINIAR 336
            :.:..||||.||:.|:|:|||||.    ...|.:||..|.:.|:    .||...|    |..:..
Mosquito   131 NRTVPKCGGALISERYVITAAHCTVDKPNWKLLYVRFNEFNTSSADNCTTENDEVICREDYAVES 195

  Fly   337 YVSHPDYNRRN--GRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEG 399
            .|.||:|:..|  ..:|:.||.|..:|.|...:.|||||...:::|...|..:..|.|||:| |.
Mosquito   196 IVPHPEYDMHNISRPNDICILRLASDVTFNDYVRPICLPFDPDVQQLPIVDEIFTVTGWGET-ED 259

  Fly   400 GESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPE 464
            ...:.....:::|..:::.|...||......|..|     ||.|.|: |.|:|:||||||||   
Mosquito   260 RRPSDTQKHVELPGLEHEACNSVYAVANVTLSDKQ-----LCIGGLN-GSDSCRGDSGGPLM--- 315

  Fly   465 PYQGQLR--FYLIGVVSYGIG-CARPNVPGVYSSTQYFMDWI 503
               .::|  ::||||||:|.. |...|:||||::...::||:
Mosquito   316 ---REVRGGWFLIGVVSFGARFCGTQNLPGVYTNVAKYLDWM 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 11/57 (19%)
Tryp_SPc 260..503 CDD:214473 92/260 (35%)
Tryp_SPc 261..503 CDD:238113 92/259 (36%)
CLIPB15XP_318957.5 CLIP 31..90 CDD:197829 12/58 (21%)
Tryp_SPc 110..353 CDD:238113 91/255 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.