DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP011427

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_317876.4 Gene:AgaP_AGAP011427 / 1278263 VectorBaseID:AGAP011427 Length:868 Species:Anopheles gambiae


Alignment Length:267 Identity:90/267 - (33%)
Similarity:132/267 - (49%) Gaps:27/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 TVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGS--PFKCGGTLITARHVLTAAHC------IRQD 310
            ||.|     ||..:.||.:..:|.:|: ..||:  .:.|||:|||.|.||||:||      :..|
Mosquito   302 TVAY-----GGVRAYKGEFQHMAAIGW-TRSGATIDYLCGGSLITWRFVLTASHCSVDSNNLPPD 360

  Fly   311 LQFVRLGEHDL-STDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPH 374
            .  ||||:.|| |||.:.....|.|||::.||.|.......|:|::.||:||...|.|...|:  
Mosquito   361 T--VRLGDTDLASTDDDESAQQIPIARFIKHPQYRESRRYYDIAVVELEKNVIPNSAICVACV-- 421

  Fly   375 TANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAV 439
               .|:......:....|:|....|.|.:..|.::|:...|..:|.:.....:|.......|.. 
Mosquito   422 ---WREPEAPEDLIDAVGFGALGFGKELSSTLQKVQLHALDATICAERIPTNRRQMPEGLRDDQ- 482

  Fly   440 LCAGVLSGGKDTCQGDSGGPLM-LPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI 503
            |||  .|...|||:|||||||. |.....|.:..:::||||:|..|...:. |||:....::|||
Mosquito   483 LCA--RSETMDTCEGDSGGPLQTLRYDLLGNIFSFIVGVVSFGTPCVEGST-GVYTRVSSYLDWI 544

  Fly   504 IQQVQDT 510
            .::|..:
Mosquito   545 EKEVNQS 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 84/252 (33%)
Tryp_SPc 261..503 CDD:238113 84/251 (33%)
AgaP_AGAP011427XP_317876.4 Tryp_SPc 21..261 CDD:238113
Tryp_SPc 21..259 CDD:214473
Tryp_SPc 306..546 CDD:238113 86/251 (34%)
Tryp_SPc 306..544 CDD:214473 84/249 (34%)
Tryp_SPc 625..862 CDD:214473
Tryp_SPc 630..864 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.