DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and SCRASP2

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_316661.5 Gene:SCRASP2 / 1277217 VectorBaseID:AGAP006631 Length:1343 Species:Anopheles gambiae


Alignment Length:286 Identity:95/286 - (33%)
Similarity:136/286 - (47%) Gaps:45/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 CGSTVG--YF---KKIVGGEVSRKGAWPWIALLGYDDPSGSP---FKCGGTLITARHVLTAAHCI 307
            ||....  ||   |:||||..|..|.||:||.:     .|.|   |.|.|.||..:.||||:|||
Mosquito  1065 CGKVRNRKYFKATKRIVGGSTSNPGDWPFIAAI-----LGGPEEVFYCAGVLIADQWVLTASHCI 1124

  Fly   308 RQDLQ----------FVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGR-SDMAILYLERNV 361
            .....          .::||.....:.|..|. .:.:...:.||.||..... :|:|:..|...|
Mosquito  1125 GNSPTSHTMRNVNDWTIQLGITRRRSHTYYGQ-KVKVKTVIPHPMYNLHIPHDNDIALFQLATRV 1188

  Fly   362 EFTSKIAPICL--PHTANLRQKSYVGYMPFVAGWGK------TMEGGESAQVLNELQIPIYDNKV 418
            .|...:.|:||  ||...|.    .|....|.||||      |..|......|||:.:||...::
Mosquito  1189 AFHEHLLPVCLPPPHIRELP----TGINCTVVGWGKREERNSTPNGASYEPTLNEVNVPIVSREL 1249

  Fly   419 CVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIG 483
            |:.       :.......:.::|||...||:|.|||||||||:.|.|.:.. |:::.|:||:|:.
Mosquito  1250 CID-------WLETFNVTEGMICAGYQEGGRDACQGDSGGPLLCPYPNEKD-RWFVGGIVSWGVR 1306

  Fly   484 CARPNVPGVYSSTQYFMDWIIQQVQD 509
            ||.|.:||||::...|:.||:.|:.:
Mosquito  1307 CAHPKLPGVYANVPKFIPWILAQINN 1332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 87/264 (33%)
Tryp_SPc 261..503 CDD:238113 87/263 (33%)
SCRASP2XP_316661.5 Fz 753..857 CDD:279700
LDLa 889..918 CDD:238060
LDLa 921..955 CDD:294076
SRCR_2 956..>1011 CDD:295335
Tryp_SPc 1079..1326 CDD:214473 87/264 (33%)
Tryp_SPc 1080..1326 CDD:238113 87/263 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.