DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and SP24D_ANOGA

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_316450.1 Gene:SP24D_ANOGA / 1277027 VectorBaseID:AGAP006416 Length:271 Species:Anopheles gambiae


Alignment Length:259 Identity:74/259 - (28%)
Similarity:115/259 - (44%) Gaps:58/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWP-WIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVRLGEHDLST 323
            :||||.|:.:|.:| .:|||     .|:...|||:||.:|.|||||||:......|...    |.
Mosquito    49 RIVGGSVASEGQFPHQVALL-----RGNALTCGGSLIESRWVLTAAHCVYNGALVVPAS----SI 104

  Fly   324 DTETGHVDIN------IARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKS 382
            ....|.|.::      :||.:.|..|.  |.::|:|:|.|:.::..::.|.||.| .|.::...|
Mosquito   105 VVVAGSVSLSNGVRRAVARVIPHERYG--NFKNDVALLQLQLSLPSSAYIRPIAL-RTTSVPAGS 166

  Fly   383 YVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSG 447
            .|    .::|||:..:||..:.:|.      |:....|           |||  :..:..|:.:|
Mosquito   167 EV----VISGWGRMYQGGPVSNMLR------YNRATVV-----------ADQ--QCRMATGISTG 208

  Fly   448 --------GKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI 503
                    ....|.||||||.:|..        .|:||.::.|.......|..|:....|:.||
Mosquito   209 LICFTSPVNNGACNGDSGGPAILNN--------QLVGVANFIINYCGSASPDGYARVSDFVTWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 72/257 (28%)
Tryp_SPc 261..503 CDD:238113 72/256 (28%)
SP24D_ANOGAXP_316450.1 Tryp_SPc 49..264 CDD:214473 72/257 (28%)
Tryp_SPc 50..267 CDD:238113 74/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.