DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP006385

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_316419.4 Gene:AgaP_AGAP006385 / 1276997 VectorBaseID:AGAP006385 Length:260 Species:Anopheles gambiae


Alignment Length:248 Identity:78/248 - (31%)
Similarity:122/248 - (49%) Gaps:24/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI--RQDLQFVRLGEHDLS 322
            ::|.||.::.|.:|:...|.....:|....|||:|:....||||.||:  .:.:: |.||..|.|
Mosquito    27 RVVNGETAKLGQFPYQVRLTLHVGNGQQALCGGSLLNEEWVLTAGHCVMLAKSVE-VHLGAVDFS 90

  Fly   323 TDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYM 387
            .:|..|.:.:....:..|..||.....:|:|::.|...|||:.::.|:.||    ...:.:.|..
Mosquito    91 DNTNDGRLVLESTEFFKHEKYNPLFVANDVALVKLPSKVEFSERVQPVRLP----TGDEDFAGRE 151

  Fly   388 PFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTC 452
            ..|:|||..:.||:.||.|....:.:..||.|       ::.||.....|:.||| |....:..|
Mosquito   152 VVVSGWGLMVNGGQVAQELQYATLKVIPNKQC-------QKTFSPLLVRKSTLCA-VGEELRSPC 208

  Fly   453 QGDSGGPLMLPEPYQGQLRFYLIGVVSYG--IGCARPNVPGVYSSTQYFMDWI 503
            .|||||||:|.|...      |:||||:|  .||.:.: |..::....|.||:
Mosquito   209 NGDSGGPLVLAEDKT------LVGVVSFGHAQGCDKGH-PAAFARVTAFRDWV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 77/246 (31%)
Tryp_SPc 261..503 CDD:238113 77/245 (31%)
AgaP_AGAP006385XP_316419.4 Tryp_SPc 27..254 CDD:214473 77/246 (31%)
Tryp_SPc 28..257 CDD:238113 78/247 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.