DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP006192

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_316257.4 Gene:AgaP_AGAP006192 / 1276857 VectorBaseID:AGAP006192 Length:346 Species:Anopheles gambiae


Alignment Length:277 Identity:79/277 - (28%)
Similarity:127/277 - (45%) Gaps:39/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 CGSTVGYFKK--IVGGEVSRKGAWPW-IALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQ 312
            ||. |...|:  |.||..|..|.||| :|:...:....:.:|||||:|....||||.||:.::.:
Mosquito    26 CGQ-VQVLKQGLIFGGTASTPGMWPWHVAVFHRESIRRTSYKCGGTIINRDTVLTAYHCVVENQR 89

  Fly   313 -------FVRLGEHDLSTDTETGHVDIN-IARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAP 369
                   ..|.|..||.....|  |..| :...:|.|..:.|....|:|||.::....:...:.|
Mosquito    90 PIAAGRLVARAGLFDLDVGGPT--VQENRVFDVISPPGASARTFDDDIAILKMQTQFTYDDYVQP 152

  Fly   370 ICLPHTANLRQK--SYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSA 432
            :|:   .::||.  ..||....|.|||.|.:...||: |.:..:|:...:.|:   |.::..||.
Mosquito   153 VCI---RSVRQDIGQLVGAYGTVVGWGWTEQSTTSAE-LRQANVPVVSAEDCL---ASDRNLFSQ 210

  Fly   433 DQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGV----- 492
            ....| |.||| ...|..:|.|||||.:.    ::....::|.|:.|:....|:.:  |:     
Mosquito   211 VLTTK-VYCAG-SRNGTSSCNGDSGGGMF----FRMSGYWFLRGLTSFSAVDAKQS--GICDSHG 267

  Fly   493 ---YSSTQYFMDWIIQQ 506
               |:....::||:.:|
Mosquito   268 YVGYTDVAKYLDWLREQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 73/263 (28%)
Tryp_SPc 261..503 CDD:238113 73/260 (28%)
AgaP_AGAP006192XP_316257.4 Tryp_SPc 37..284 CDD:238113 74/263 (28%)
Tryp_SPc 37..280 CDD:214473 72/259 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.