DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP005704

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_315712.4 Gene:AgaP_AGAP005704 / 1276373 VectorBaseID:AGAP005704 Length:305 Species:Anopheles gambiae


Alignment Length:261 Identity:75/261 - (28%)
Similarity:115/261 - (44%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 KKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVRLGEHDLST 323
            ::|:.|....:|..|:.|.:...:...:.| |||.|::...|||||.|:.        |:.|||.
Mosquito    60 QRILNGVTVARGDIPYAAAILISEEFATYF-CGGVLVSELFVLTAASCVE--------GDRDLSI 115

  Fly   324 DTETGHVDIN-------IARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQK 381
            ........||       ::..:.||    ....:|:|:|.|.|.|.....|.|:.||   |.||:
Mosquito   116 TVLLDAAQINTAGEFIAVSEIIVHP----APSDNDIALLRLNRAVRLNDNIRPVTLP---NRRQR 173

  Fly   382 --SYVGYMPFVAGWGKTMEGGESAQVLNELQI---PIYDNKVCVQSYAKEKRYFSADQFDKAVLC 441
              ::|..:..::|||:|......|..||.|::   .:..|..|..|:.    :...||.    :|
Mosquito   174 TMTFVNQLASISGWGRTASNTNEALPLNNLRLVRNHVMSNFNCGVSFP----FTITDQH----IC 230

  Fly   442 AGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSY----GIGCARPNVPGVYSSTQYFMDW 502
            ....||  ..|.||.||||...:...|  |.:|||:.|:    |.|..||.   |::....::||
Mosquito   231 ITGDSG--SACAGDEGGPLTTVDVVTG--RTFLIGLYSFTSFLGCGMGRPT---VHTRITEYLDW 288

  Fly   503 I 503
            |
Mosquito   289 I 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 73/258 (28%)
Tryp_SPc 261..503 CDD:238113 73/257 (28%)
AgaP_AGAP005704XP_315712.4 Tryp_SPc 61..289 CDD:214473 73/258 (28%)
Tryp_SPc 62..292 CDD:238113 75/259 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.