DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP005669

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_315686.1 Gene:AgaP_AGAP005669 / 1276349 VectorBaseID:AGAP005669 Length:301 Species:Anopheles gambiae


Alignment Length:257 Identity:75/257 - (29%)
Similarity:134/257 - (52%) Gaps:31/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWPW-IALLG-YDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVR------L 316
            ::..|:.:..|.:|: |||:. :...||   .|||:::|...:||||||:......:.      :
Mosquito    55 RVTNGQEATPGQFPYQIALVSEFVITSG---LCGGSVLTNNFILTAAHCVVGTAGILASGGTAII 116

  Fly   317 GEHDLST-DTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQ 380
            |.|:.:| :.....:..:....:.||.|...|.|:|:|::.|:..:.|..::.|:.||..::.||
Mosquito   117 GAHNRNTAEASQQRIRFSGPGVIPHPFYASSNLRNDIALVRLDAPIVFNDRVQPVRLPARSDTRQ 181

  Fly   381 KSYVGYMPFVAGWGKTMEGG-ESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGV 444
              :.|::..|:|:|:|.:.. .::.|:.....|:..|..|:      .::.||....:.|..:| 
Mosquito   182 --FGGFLGTVSGFGRTSDASTATSDVVMFTTNPVMTNADCI------AQWNSALIEPQQVCLSG- 237

  Fly   445 LSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGI--GCARPNVPGVYSSTQYFMDWII 504
             .||:..|.|||||||.:.:  .|.|:   |||||:|.  ||: ..:|.||:...:|:|||:
Mosquito   238 -EGGRSACNGDSGGPLAVQD--GGSLQ---IGVVSFGSAGGCS-IGMPSVYARVSFFLDWIV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 73/254 (29%)
Tryp_SPc 261..503 CDD:238113 73/253 (29%)
AgaP_AGAP005669XP_315686.1 Tryp_SPc 55..291 CDD:214473 73/254 (29%)
Tryp_SPc 56..291 CDD:238113 73/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.