DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP008649

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_314746.4 Gene:AgaP_AGAP008649 / 1275498 VectorBaseID:AGAP008649 Length:312 Species:Anopheles gambiae


Alignment Length:292 Identity:103/292 - (35%)
Similarity:144/292 - (49%) Gaps:49/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 NTTPAPSQI--------VPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGY 280
            |.||..|.|        ||  ...:|..|               :::||..|....:||:|.|.|
Mosquito    33 NPTPILSSISRSVVCGKVP--NPPLPNSL---------------RVIGGNTSDIDQYPWMAALYY 80

  Fly   281 DDPSGSPFKCGGTLITARHVLTAAHCI-RQDLQ--FVRLGEHDLST-DTETGHVDINIARYVSHP 341
                ...|.|||:||..|::||||||: |.|..  .|.|...::.| :.|..|  ..:||.|.: 
Mosquito    81 ----RQQFTCGGSLINDRYILTAAHCVARMDAAGFEVYLRRPNIVTLNPEAVH--RRVARIVMN- 138

  Fly   342 DYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVL 406
            .|......:|:|:|.|:..|.....:.|||||    :...::.|....|.||| |.|.||.::.|
Mosquito   139 RYQELRNNNDVALLLLKEPVGVADGLVPICLP----VDGSNFDGKEAIVTGWG-TTESGELSEHL 198

  Fly   407 NELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLR 471
            .:|.:||..|:.|     ::..||.. |....:||||.|.||:|:|||||||||.|.:....|.:
Mosquito   199 QQLTVPILTNQQC-----RKSGYFRF-QITAKMLCAGYLEGGRDSCQGDSGGPLQLAKGETDQQQ 257

  Fly   472 FYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI 503
              ::||||:|..||:.|.||||:....|:.||
Mosquito   258 --IVGVVSWGNECAQRNYPGVYARVTRFVSWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 92/246 (37%)
Tryp_SPc 261..503 CDD:238113 92/245 (38%)
AgaP_AGAP008649XP_314746.4 Tryp_SPc 60..287 CDD:214473 92/246 (37%)
Tryp_SPc 61..290 CDD:238113 94/247 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.