DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP004570

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_313874.5 Gene:AgaP_AGAP004570 / 1274709 VectorBaseID:AGAP004570 Length:259 Species:Anopheles gambiae


Alignment Length:255 Identity:87/255 - (34%)
Similarity:140/255 - (54%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIR---QDLQFVRLGEHDL 321
            :||||..:....:||:|.|.||    ..|.||.:|:|..:|||||||:|   ::...|.||::|.
Mosquito    21 RIVGGRPTGVNQYPWLARLVYD----GQFHCGASLLTKDYVLTAAHCVRRLKRNKIRVILGDYDQ 81

  Fly   322 STDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSY-VG 385
            ...:||..:...:...:.|..:::.:...|:|:|.|.:.||||..|.|:|||     :::|. .|
Mosquito    82 FVASETPAIMRAVTAIIRHRSFDQNSYNHDIALLKLRKPVEFTKTIRPVCLP-----KERSEPAG 141

  Fly   386 YMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKD 450
            .:..|.|||:|.|||....::..:.:||.....|     :..:| .|.:....:||||  .|.:|
Mosquito   142 QLGTVVGWGRTSEGGTLPALVQHVDVPILTLDQC-----RSMKY-RASRITSNMLCAG--KGKQD 198

  Fly   451 TCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQVQDT 510
            :|||||||||::    :...:..::|:||:|:||.|...||||:....::.|:...:.||
Mosquito   199 SCQGDSGGPLLV----RNGDKHEIVGIVSWGVGCGRAGYPGVYTRVARYLPWLRANLDDT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 84/246 (34%)
Tryp_SPc 261..503 CDD:238113 84/245 (34%)
AgaP_AGAP004570XP_313874.5 Tryp_SPc 21..246 CDD:214473 84/245 (34%)
Tryp_SPc 22..250 CDD:238113 85/248 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.