DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP003248

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_312959.4 Gene:AgaP_AGAP003248 / 1273921 VectorBaseID:AGAP003248 Length:296 Species:Anopheles gambiae


Alignment Length:306 Identity:91/306 - (29%)
Similarity:148/306 - (48%) Gaps:59/306 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 TPAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGS-PFK 289
            |||...::|:            ...||:...  ::::...|::....||:||:.|..|:|| .:.
Mosquito    27 TPAQKSLLPQ------------PPMCGNDAP--ERLITSLVAQLDEAPWMALIEYWKPNGSLSYL 77

  Fly   290 CGGTLITARHVLTAAHCIRQ-----DLQFVRLGEHDLSTDTETGH-------VDINIARYVSHPD 342
            |||:||..|:|:|||||:..     .:..:||||.||||..:..|       :|:.:.:...|.|
Mosquito    78 CGGSLINERYVVTAAHCVTSLPQGWTVHRIRLGEWDLSTSEDCDHSRCNDAPIDVAVDKITVHED 142

  Fly   343 YN--RRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSY-----VGYMPFVAGWGKTMEGG 400
            |.  .||.|:|:|::.|:|.:.:|..:||||||....|:.:.|     ||::.  ..:|..  ||
Mosquito   143 YKSPSRNHRNDIALIRLDRQMHYTETVAPICLPQNGPLQTQRYRTMHSVGWIE--ENFGPI--GG 203

  Fly   401 ESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEP 465
            :..||..:|    .|.:.|..:|.:.....:..|     ||   ::..||.....:|||||  :.
Mosquito   204 KKLQVEQDL----VDFQNCSSNYLQASIALADTQ-----LC---VAQQKDNRIDIAGGPLM--QR 254

  Fly   466 YQGQLRFYLIGVVSYG---IGCARPNVPGVYSSTQYFMDWIIQQVQ 508
            ..|  .:||.||.|:|   .|..  .:|.||::...::|||...::
Mosquito   255 IAG--HWYLFGVASFGGRNYGTV--ELPNVYTNVMEYVDWIESNIE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 83/265 (31%)
Tryp_SPc 261..503 CDD:238113 83/264 (31%)
AgaP_AGAP003248XP_312959.4 Tryp_SPc 53..291 CDD:214473 83/259 (32%)
Tryp_SPc 54..294 CDD:238113 84/261 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.