DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and CLIPB2

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_312956.3 Gene:CLIPB2 / 1273920 VectorBaseID:AGAP003246 Length:355 Species:Anopheles gambiae


Alignment Length:365 Identity:131/365 - (35%)
Similarity:183/365 - (50%) Gaps:47/365 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 RGTVCRGPDTKPGNCVEIKECASLLNELRSRSQDATFANFLRASNAVCQNKGTQVCCPTGQGITN 224
            :|..|..|..:.|.||.::||||||.....|........||.:|......:.|.|||.:.|. |.
Mosquito    22 QGQRCVNPARQTGKCVLVRECASLLAIYSKRFTTPEETQFLASSRCGEIGRKTLVCCASEQQ-TR 85

  Fly   225 TTPAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGS-PF 288
            |:..|:.  |:               ||..|  ..:|:||:.:....:||.||:.|..|... .|
Mosquito    86 TSSFPTS--PE---------------CGIQV--TDRIIGGQTTELEEFPWTALIEYRKPGNQYDF 131

  Fly   289 KCGGTLITARHVLTAAHCIRQ-----DLQFVRLGEHDLSTDTE-------TGHVDINIARYVSHP 341
            .|||.||.||::||||||::.     .|..|||||.||||..:       .|.:|:.|..:|:|.
Mosquito   132 HCGGALINARYILTAAHCVQSLPRGWQLNGVRLGEWDLSTANDCSDGICSAGPIDLEIESFVAHA 196

  Fly   342 DYNRRN--GRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQ 404
            .|:..:  ..:|:|::.|.::|..:..|.|||||.|...|.::.||.:.|.||||||.....|.:
Mosquito   197 GYDAADTAHTNDIALIRLRQDVASSEMIRPICLPLTEPQRSRNRVGTVSFAAGWGKTESASASER 261

  Fly   405 VLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQ 469
            .| ::::.:.|...|.|.|........|.|     :|||.|. |||||.||||||||.    :..
Mosquito   262 KL-KVELTVQDPSRCRQIYRGINIALKASQ-----MCAGGLQ-GKDTCTGDSGGPLMA----KSA 315

  Fly   470 LRFYLIGVVSYGIG-CARPNVPGVYSSTQYFMDWIIQQVQ 508
            ..:|||||||:|:. |.....||||::...::|||...||
Mosquito   316 GAWYLIGVVSFGLSKCGTAGYPGVYTNVVEYLDWIESNVQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 17/51 (33%)
Tryp_SPc 260..503 CDD:214473 99/258 (38%)
Tryp_SPc 261..503 CDD:238113 99/257 (39%)
CLIPB2XP_312956.3 CLIP 26..78 CDD:288855 17/51 (33%)
Tryp_SPc 102..350 CDD:214473 99/258 (38%)
Tryp_SPc 103..353 CDD:238113 101/260 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.