DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP010635

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_307830.4 Gene:AgaP_AGAP010635 / 1269219 VectorBaseID:AGAP010635 Length:569 Species:Anopheles gambiae


Alignment Length:308 Identity:88/308 - (28%)
Similarity:132/308 - (42%) Gaps:60/308 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 QIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFK--CGGT 293
            :|...|.:|...||:..:|          .:.||..:..|.|||.|.|.:...:...|:  ||.|
Mosquito    28 EIYDYNDNECGERLVKRQE----------LVKGGYSTHPGDWPWHAALYHRGFNSRDFEYACGST 82

  Fly   294 LITARHVLTAAHC---------IRQDLQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGR 349
            ::....|:|||||         |..|...:|||..:|..:.|....:.::...:.|..|......
Mosquito    83 IVHRYLVITAAHCVTFATSRRKIPSDNMQLRLGRFNLMNNEEEYAEEFSVIDTIVHEGYRPTTLE 147

  Fly   350 SDMAILYLERNVEFTSKIAPIC---------LPHTANLRQKSYVGYMP-FVAGWGKTMEGGESAQ 404
            :|:|||.:|..:.|...|.|:|         ||:..|         .| .|.|||.: |......
Mosquito   148 NDIAILRVEIPIIFNDYIQPVCLWKRDDGFDLPNVYN---------QPGTVVGWGLS-ENNRIGT 202

  Fly   405 VLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQ 469
            .|||.|:|:.::..|:   |.::.:|......|| .||| ...|...|.|||||.:.    :|.|
Mosquito   203 TLNEAQMPVVNSWTCL---ASDRAFFGRFLQSKA-FCAG-YKNGTGVCNGDSGGGMF----FQFQ 258

  Fly   470 LRFYLIGVVS------YGIGCARPNVPGVYSSTQYFMDWIIQQVQDTP 511
            .|:||.|:||      |...|......|...::|| :||:   .::||
Mosquito   259 NRWYLKGIVSFSSVNDYSGWCNLRQYIGFTDASQY-IDWV---YENTP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 79/269 (29%)
Tryp_SPc 261..503 CDD:238113 79/268 (29%)
AgaP_AGAP010635XP_307830.4 Tryp_SPc 50..300 CDD:238113 80/272 (29%)
Tryp_SPc 50..297 CDD:214473 79/266 (30%)
Tryp_SPc 342..563 CDD:214473
Tryp_SPc 342..563 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.