DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP012473

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_307308.4 Gene:AgaP_AGAP012473 / 1268739 VectorBaseID:AGAP012473 Length:272 Species:Anopheles gambiae


Alignment Length:325 Identity:86/325 - (26%)
Similarity:128/325 - (39%) Gaps:92/325 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LRASNAVCQNKGTQVCCPTGQGITNTTPAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGG 264
            |...|||..|...|                      ||.|.|.....:..|....:..:|..:..
Mosquito    12 LFCGNAVVTNANVQ----------------------NTKEGPSHSGRIVNGVPVNISNYKYALSM 54

  Fly   265 EVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI------RQDLQFVRLGEHDLST 323
            .::                  ..|:||.::||..|.|:||||:      |     :.|..:..||
Mosquito    55 RLN------------------GEFRCGASIITCSHALSAAHCVYNLTGPR-----IELTLYGGST 96

  Fly   324 DTETGHVDINIARYVSHPDYNRRNGRS-----DMAILYLERNVEFTSK--IAPICLPHTANLRQK 381
            ...:|.|:..:.....|| |.:.|.:|     |:|||.:..| .|:.:  :||:.| .|..|.  
Mosquito    97 SASSGGVEFPVVGGAIHP-YYKPNSQSNTSDYDVAILNVPAN-SFSGRPNMAPLAL-QTKELP-- 156

  Fly   382 SYVGYMPFVAGWGKTMEGGESAQV-LNEL---QIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCA 442
              ||...||.|||:|   ||:..| .|:|   .:.|.....|...:|..::..:.   .|.::||
Mosquito   157 --VGTRCFVVGWGRT---GENQPVSTNQLLYANMNIVSQSSCASMWANFEKLCAE---CKHMVCA 213

  Fly   443 GVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGC--------ARPNVPGVYSSTQYF 499
            ...: |.|||:|||||.|:.    .|:    |.||||:|..|        |:...|.:.|..|.:
Mosquito   214 QYYN-GMDTCRGDSGGALVC----GGR----LTGVVSFGPYCSGVWPSVFAKVTAPSMRSFIQLY 269

  Fly   500  499
            Mosquito   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 6/15 (40%)
Tryp_SPc 260..503 CDD:214473 74/265 (28%)
Tryp_SPc 261..503 CDD:238113 74/264 (28%)
AgaP_AGAP012473XP_307308.4 Tryp_SPc 36..266 CDD:214473 75/274 (27%)
Tryp_SPc 37..267 CDD:238113 75/274 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.