DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP013487

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_003436426.1 Gene:AgaP_AGAP013487 / 11176153 VectorBaseID:AGAP013487 Length:308 Species:Anopheles gambiae


Alignment Length:285 Identity:92/285 - (32%)
Similarity:153/285 - (53%) Gaps:34/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 KNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGS-PFKCGGTLITAR 298
            :||..:|.     ...||..:|  .:::.|:.::...:||.||:.:..|.|| .|.|||:||..|
Mosquito    37 QNTSSLPE-----SPHCGIQLG--DRVLSGQSTQIDEFPWTALIEFQKPDGSFGFHCGGSLINDR 94

  Fly   299 HVLTAAHCIRQ-----DLQFVRLGEHDLSTDTETGH-------VDINIARYVSHPDYNR--RNGR 349
            :::||||||:.     .:|.|||||.||::..:..:       :|::|.:.|.|..|:.  ::..
Mosquito    95 YIVTAAHCIKSIPRDWKVQRVRLGEWDLTSANDCQNEFCSDAPIDLDIEQIVVHTGYDTKDKSNA 159

  Fly   350 SDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIY 414
            :|:|::...|.|.::..:.|||||.:::||.:|:.|.:.:..||.||.....|.:.| ::::.|.
Mosquito   160 NDIALIRFTRPVNYSQTVRPICLPLSSSLRNRSHDGLISYEVGWRKTNSATASEKKL-KVEVEIK 223

  Fly   415 DNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVS 479
            ..:.|...|.:     :.....:..:|||.:. .||||.|:||||||    .|....:|||||.|
Mosquito   224 SLQECAPIYER-----NGILLKQTHMCAGGVR-SKDTCSGNSGGPLM----RQMTGSWYLIGVNS 278

  Fly   480 YG-IGCARPNVPGVYSSTQYFMDWI 503
            :| ..|....||.||::...::|||
Mosquito   279 FGPRKCGTFGVPDVYTNVAEYVDWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 84/258 (33%)
Tryp_SPc 261..503 CDD:238113 84/257 (33%)
AgaP_AGAP013487XP_003436426.1 Tryp_SPc 55..303 CDD:214473 84/258 (33%)
Tryp_SPc 59..306 CDD:238113 86/256 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.