DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and AgaP_AGAP013452

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_003435969.1 Gene:AgaP_AGAP013452 / 11175626 VectorBaseID:AGAP013452 Length:379 Species:Anopheles gambiae


Alignment Length:281 Identity:82/281 - (29%)
Similarity:135/281 - (48%) Gaps:42/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 VEEGCG-STVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCI--- 307
            :..||| ..|.|...|:||:.:..|.|||.|::.:.........|||::|....:||||||:   
Mosquito    26 LRRGCGVRKVHYNNLILGGQKAPAGKWPWHAIIVHRAGDTVQAVCGGSIIDKYTILTAAHCLYTT 90

  Fly   308 -----RQDLQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKI 367
                 |..|| |.:|...||...:... ..:..|::.|..|::.:.|.|:|::.:.:.:|.::.|
Mosquito    91 HGVIARNRLQ-VYVGRTQLSVIDDRSR-SYSAERFIVHTGYSQLHVRDDIALIKVTKEIEMSAFI 153

  Fly   368 APICLPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSA 432
            .|:||..:..:.....||....|.|:|.| :..:.:.|:.:.::|:.|...|::|    .|....
Mosquito   154 QPVCLWPSEPISGTDIVGRRGAVVGFGLT-DVDKPSDVMLDAEVPVVDLWSCLES----NRAAFG 213

  Fly   433 DQFDKAVLCAGVLSGGKD---TCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYS 494
            ....:.:|||    ||:|   .|.|||||.|.|.   .|.: :|:.|:||:.     ||:.||..
Mosquito   214 KHLARTMLCA----GGRDGVGPCNGDSGGGLFLE---IGGV-WYVRGIVSFA-----PNLDGVLK 265

  Fly   495 S--TQY--------FMDWIIQ 505
            .  |||        ::|||.:
Mosquito   266 CDFTQYTVFTDVAKYLDWIAE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 75/263 (29%)
Tryp_SPc 261..503 CDD:238113 75/262 (29%)
AgaP_AGAP013452XP_003435969.1 Tryp_SPc 41..286 CDD:238113 77/264 (29%)
Tryp_SPc 41..284 CDD:214473 75/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.