DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and PRSS21

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:268 Identity:99/268 - (36%)
Similarity:130/268 - (48%) Gaps:34/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 CGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIR--QDLQ- 312
            ||..| ...:|||||.:..|.|||...|...|    ...||.:|::.|..||||||..  .||. 
Human    33 CGRRV-ITSRIVGGEDAELGRWPWQGSLRLWD----SHVCGVSLLSHRWALTAAHCFETYSDLSD 92

  Fly   313 ----FVRLGEHDLSTDTETGHVDINIARY-VSH----PDYNRRNGRSDMAILYLERNVEFTSKIA 368
                .|:.|:  |::......:.....|| ||:    |.| ..|...|:|::.|...|.:|..|.
Human    93 PSGWMVQFGQ--LTSMPSFWSLQAYYTRYFVSNIYLSPRY-LGNSPYDIALVKLSAPVTYTKHIQ 154

  Fly   369 PICL-PHTANLRQKSYVGYMPFVAGWG--KTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYF 430
            |||| ..|.....::..    :|.|||  |..|...|...|.|:|:.|.:|.:|...:.|..  |
Human   155 PICLQASTFEFENRTDC----WVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYS--F 213

  Fly   431 SADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSS 495
            ..|.|...| |||...||||.|.|||||||...:  .|  .:|.|||||:|:||.|||.||||::
Human   214 RKDIFGDMV-CAGNAQGGKDACFGDSGGPLACNK--NG--LWYQIGVVSWGVGCGRPNRPGVYTN 273

  Fly   496 TQYFMDWI 503
            ..:..:||
Human   274 ISHHFEWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 94/257 (37%)
Tryp_SPc 261..503 CDD:238113 94/256 (37%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 96/258 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.