DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and ovch2

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_031756362.1 Gene:ovch2 / 100496902 XenbaseID:XB-GENE-955935 Length:1023 Species:Xenopus tropicalis


Alignment Length:317 Identity:100/317 - (31%)
Similarity:148/317 - (46%) Gaps:65/317 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 EIPRRLLNV--------------EEGCGSTVG---------------YFKKIVGGEVSRKGAWPW 274
            ::|||.|.|              ||..||..|               |..:||||..|:||..||
 Frog    13 KMPRRNLLVRSILLSLAVISCLGEEDPGSIRGARCGESPLGSARDLNYLSRIVGGRESKKGQHPW 77

  Fly   275 IALLGYDDPSGSPFKCGGTLITARHVLTAAHCI--RQDLQFVRL--GEHD--LSTDTETGHVDIN 333
            ...|   ..:|..| |||.|::.||||||:||:  |....::|:  ||:|  :..|||.....|.
 Frog    78 TVSL---KRNGKHF-CGGILVSRRHVLTASHCLLDRNVKSYIRVFFGEYDQTIKEDTEQTFKVIE 138

  Fly   334 IARYVSHPDYNRRNGRS-DMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTM 397
            |.:   |||:|.....: |:|:|.|:..|.|...|.|.|:|:..::.:.   |.:....|||...
 Frog   139 IFK---HPDFNYTQPMNYDVAVLVLDGAVTFDDNIQPACMPNPDDVFEP---GDLCVTLGWGHLT 197

  Fly   398 EGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLML 462
            |.|....||.|:.:|:.:..:|:...|..|....:.:    ::|||...||||.|||||||||:.
 Frog   198 ENGILPGVLQEVLLPLVNLSICLDVMATLKGAVVSSK----IVCAGFPEGGKDACQGDSGGPLLC 258

  Fly   463 PEPYQGQLRFYLIGVVSYGIGCA------------RPNVPGVYSSTQYFMDWIIQQV 507
            ...:.   .:.|.|:.|:|:||.            |...||:::..|..:.|:..|:
 Frog   259 QRRHG---TWVLHGLTSWGMGCGRSWKNNMFLPANRKGSPGIFTDIQKLLGWVSFQL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 87/261 (33%)
Tryp_SPc 261..503 CDD:238113 87/260 (33%)
ovch2XP_031756362.1 Tryp_SPc 64..309 CDD:238113 88/261 (34%)
CUB 330..436 CDD:238001
CUB 447..558 CDD:238001
Tryp_SPc 606..832 CDD:238113
CUB 888..1000 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.