DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and prss8l.5 loc108703873

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_002939739.1 Gene:prss8l.5 loc108703873 / 100494289 XenbaseID:XB-GENE-22167980 Length:353 Species:Xenopus tropicalis


Alignment Length:270 Identity:94/270 - (34%)
Similarity:140/270 - (51%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LNVEEG---CGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHC 306
            |.|.|.   || |.....:|:||:.|::|.|||...:..:|.|    .|||:|||::.|::|:||
 Frog    18 LGVSEAVAQCG-TRQVSTRIMGGQDSQQGMWPWQVNIRSNDFS----FCGGSLITSKWVISASHC 77

  Fly   307 IRQ----DLQFVRLGEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKI 367
            ..:    ....|.||.:.| |......:.:.|.|::.||:|.......|:.::.|..:|.||:.|
 Frog    78 FNRTNPPSFYTVYLGSYQL-TGANGNEIPMAIQRFIVHPNYTSPEYGHDITLVELSSDVNFTNYI 141

  Fly   368 APICLPHTANLRQKSYVGYMPFVAGWGKTMEGG--ESAQVLNELQIPIYDNKVCVQSYAKEKRYF 430
            .|:||| :|.:...:  |...:|.|||......  .....|.::.:|:..|:.| .|..:.....
 Frog   142 QPVCLP-SAGVNFPT--GLQCWVTGWGNIASNVSLRDPNTLQQVAVPLIGNQQC-NSILQAPSPL 202

  Fly   431 SADQFD--KAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVY 493
            ....|.  ..:||||.:.||||:|||||||||:.....|    :||:||||:|.||.:||.||||
 Frog   203 GPSSFAILNDMLCAGYIDGGKDSCQGDSGGPLVCAAANQ----WYLVGVVSFGDGCGQPNRPGVY 263

  Fly   494 SSTQYFMDWI 503
            .....::|||
 Frog   264 VRVTAYLDWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 86/250 (34%)
Tryp_SPc 261..503 CDD:238113 86/249 (35%)
prss8l.5 loc108703873XP_002939739.1 Tryp_SPc 35..273 CDD:214473 86/250 (34%)
Tryp_SPc 36..275 CDD:238113 88/251 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.