DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and tmprss11f

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_004911133.1 Gene:tmprss11f / 100379970 XenbaseID:XB-GENE-1012399 Length:427 Species:Xenopus tropicalis


Alignment Length:387 Identity:103/387 - (26%)
Similarity:163/387 - (42%) Gaps:106/387 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 ASLLNELRSRSQDATFANFLRASNAVCQNKGTQV--------------CCPTGQGI-----TNTT 226
            |.:...|.|..:|:...|...:|..:..:.|:.:              ...|.|||     .||:
 Frog    77 AKIAKVLDSAYEDSELKNQYNSSQVISLSPGSVIPVFVLLFNFVNNGSSASTVQGIFVENMKNTS 141

  Fly   227 PAPSQIVPKNTDEIPRRLLNVEE----------------------------GCGSTVG---YFKK 260
                    |...::.:..|::.|                            .||  :|   ...:
 Frog   142 --------KTGFDVDQSSLHLSEISSSDAQNLLYSVPSTTTAYTTTAADFTACG--IGGPSVSNR 196

  Fly   261 IVGGEVSRKGAWPW---IALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVRLGEHDLS 322
            ||||..:..|:|||   :.|||       ...||.:|:....::.||||.            |::
 Frog   197 IVGGTNAGLGSWPWQASLRLLG-------SHTCGASLLNDTWLVAAAHCF------------DMN 242

  Fly   323 TDTETGHV-----------DINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTA 376
            .|..:..|           :..|.:.:.:..|...|.|:|:|:|.|...:.|||.|.|:|||..:
 Frog   243 ADANSWTVVLGTINVYSGSEFKIEKIIIYEGYTSHNHRNDIALLKLFTPLNFTSIIRPVCLPEAS 307

  Fly   377 NLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLC 441
            ::...   |...::.|||...:||.::|||.:.::.|.::..|..|.......:      .:::|
 Frog   308 DIFPD---GSSCYITGWGALTDGGSASQVLQQAEVKIINSDTCSSSQMYGGLIY------PSMIC 363

  Fly   442 AGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI 503
            ||..:|..|:|||||||||:..:  .|  |:.|||:||:|.|||.||.|||||...|..:||
 Frog   364 AGYATGQIDSCQGDSGGPLVTLK--SG--RWVLIGIVSFGYGCALPNKPGVYSRITYLRNWI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 7/48 (15%)
Tryp_SPc 260..503 CDD:214473 82/256 (32%)
Tryp_SPc 261..503 CDD:238113 82/255 (32%)
tmprss11fXP_004911133.1 SEA 48..148 CDD:396113 14/78 (18%)
Tryp_SPc 197..421 CDD:238113 82/255 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.