DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1299 and LOC100004427

DIOPT Version :9

Sequence 1:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:297 Identity:86/297 - (28%)
Similarity:120/297 - (40%) Gaps:54/297 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 VCCPTGQGITNTTPAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALL 278
            |.|..|..:.|......|     :|...|..||.            |||||..:.:|:|||.|.:
Zfish     6 VFCVAGAVLLNIAGCLGQ-----SDVCGRAPLNT------------KIVGGLNATEGSWPWQASI 53

  Fly   279 GYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVRLGEHD----LSTDTETGHVDINIARYVS 339
            .:  .|...|.|.|:||:.|.|||||.|      |.|:...|    |...|..|.....|.|.|.
Zfish    54 NF--KSTGQFFCSGSLISERWVLTAASC------FQRINVSDVVIYLGRLTTNGSNPYEIPRTVI 110

  Fly   340 HPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYV-GYMPFVAGWGKTMEGGE-S 402
            .....     .|:|::.|..:|.||..|.|:||....::    :| |...:|.|||.|..... .
Zfish   111 QVSVT-----EDIALVQLSSSVTFTDYIRPVCLAAAGSV----FVDGTESWVTGWGSTSSTNVIL 166

  Fly   403 AQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAG-VLSGGKDTCQGDSGGPLMLPEPY 466
            :.:|.|::.||.:|..|       .........|. |:||| |...||..|..|.|.||:..:..
Zfish   167 SDMLKEVEAPIVNNIEC-------SNINGITNLDN-VICAGFVNETGKAPCWEDFGSPLVTRQGS 223

  Fly   467 QGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWI 503
            |    :...|||.:.. |.:...|.:|:....:.:||
Zfish   224 Q----WIQSGVVVFTF-CGQNGFPTLYARVSEYEEWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 1/1 (100%)
Tryp_SPc 260..503 CDD:214473 75/249 (30%)
Tryp_SPc 261..503 CDD:238113 74/248 (30%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 75/249 (30%)
Tryp_SPc 36..257 CDD:238113 76/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.