DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and RAS2

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_014301.1 Gene:RAS2 / 855625 SGDID:S000005042 Length:322 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:103/186 - (55%)
Similarity:139/186 - (74%) Gaps:7/186 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFS 67
            ::.|||||||||||||||:|||..||:||.:|||||||||.||..|||..:.|||||||||||:|
Yeast     8 IREYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTIEDSYRKQVVIDDEVSILDILDTAGQEEYS 72

  Fly    68 AMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEE 132
            ||||||||:|||||||:::...||.||:..:.:|||||||.|..|:::||||.||::::|||.::
Yeast    73 AMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQILRVKDTDYVPIVVVGNKSDLENEKQVSYQD 137

  Fly   133 AQNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVR----KFQIAERPFIEQDYKKK 184
            ..|.::.:..|::|.|||..:||::||:.|.|:||    |:   .:...|.|..|:
Yeast   138 GLNMAKQMNAPFLETSAKQAINVEEAFYTLARLVRDEGGKY---NKTLTENDNSKQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 97/162 (60%)
RAS2NP_014301.1 small_GTPase 9..172 CDD:197466 97/162 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6945
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 1 1.000 - - X1567
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.