DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and Rras2

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_080122.2 Gene:Rras2 / 66922 MGIID:1914172 Length:204 Species:Mus musculus


Alignment Length:191 Identity:136/191 - (71%)
Similarity:160/191 - (83%) Gaps:2/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSA 68
            :.|:|||||||||||||:|||||||||||||||||||||||||.|||..|:||||||||||||.|
Mouse    13 EKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGA 77

  Fly    69 MREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEA 133
            |||||||:||||||||::.|..||:||.|||||||||||||||||:::|||.||.||:||:.||.
Mouse    78 MREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEG 142

  Fly   134 QNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAE-RPFIEQDYKKKGKRKC-CLM 192
            |..:|.|.:.|:|.|||:|:|||||||||||::||||..| .|..|...|:|.|:.| |::
Mouse   143 QQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 124/162 (77%)
Rras2NP_080122.2 M_R_Ras_like 13..176 CDD:133345 124/162 (77%)
Effector region 43..51 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 258 1.000 Domainoid score I1996
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6945
Inparanoid 1 1.050 273 1.000 Inparanoid score I2969
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - oto95186
orthoMCL 1 0.900 - - OOG6_100217
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 1 1.000 - - X1567
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.