DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and rap2a

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001030288.1 Gene:rap2a / 619593 XenbaseID:XB-GENE-479951 Length:183 Species:Xenopus tropicalis


Alignment Length:188 Identity:80/188 - (42%)
Similarity:127/188 - (67%) Gaps:11/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFS 67
            |:.||:||:|.|||||||:|:||:...|:..|||||||.|.|:..:|..|:.|:||||||.|:|:
 Frog     1 MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFA 65

  Fly    68 AMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEE 132
            :||:.|:::|:||:||:::.:..||.:|...:.||:|||..::.|:::||||.||:.:::||..|
 Frog    66 SMRDLYIKNGQGFILVYSMVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSNE 130

  Fly   133 AQNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERPFIEQDYKKKGKRKCC 190
            .:..:.:...|::|.|||.:..||:.|.|   |||:...|.:|  ::|      ..||
 Frog   131 GRALAEDWGCPFMETSAKSKTMVDELFAE---IVRQMNYAAQP--DKD------DPCC 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 72/162 (44%)
rap2aNP_001030288.1 Rap2 16..165 CDD:133376 65/151 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.