DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and RAP1B

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001010942.1 Gene:RAP1B / 5908 HGNCID:9857 Length:184 Species:Homo sapiens


Alignment Length:192 Identity:92/192 - (47%)
Similarity:132/192 - (68%) Gaps:10/192 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFS 67
            |:.|||||:|.|||||||:|:||:|..||..|||||||||.||..:|.....|:||||||.|:|:
Human     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFT 65

  Fly    68 AMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEE 132
            |||:.||::|:||.||:::...|:|:::...:.|||||||.|:.||::|||||||:.::.|..|:
Human    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQ 130

  Fly   133 AQNTSRNL-MIPYIECSAKLRVNVDQAFHELVR-IVRKFQIAERPFIEQDYKKKGKRKCCLM 192
            .||.:|.. ...::|.|||.::||::.|::||| |.||..:..        |.:.|..|.|:
Human   131 GQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPG--------KARKKSSCQLL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 85/164 (52%)
RAP1BNP_001010942.1 Rap1 3..167 CDD:133375 85/163 (52%)
Interaction with KRIT1. /evidence=ECO:0000269|PubMed:22577140 25..67 24/41 (59%)
Effector region. /evidence=ECO:0000305 32..40 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.