DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and RALA

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_005393.2 Gene:RALA / 5898 HGNCID:9839 Length:206 Species:Homo sapiens


Alignment Length:194 Identity:89/194 - (45%)
Similarity:133/194 - (68%) Gaps:9/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMR 70
            :|:::||.|||||||:|:||:...||.||:||..|||.|:..:|....::|||||||||:::|:|
Human    15 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 79

  Fly    71 EQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEAQN 135
            :.|.|||||||.||::.:..||.....|:.||||||:.:..|.|:||||.||:.::|||:|||:|
Human    80 DNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKN 144

  Fly   136 TSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERPFIEQDYKKKGK-------RKCCLM 192
            .:....:.|:|.|||.|.|||:.|.:|:|.:|..::.:..  |::.|||.|       .:||::
Human   145 RAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSK--EKNGKKKRKSLAKRIRERCCIL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 81/160 (51%)
RALANP_005393.2 RalA_RalB 15..177 CDD:206710 81/161 (50%)
Effector region 43..51 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.